KEGG   Corynebacterium diphtheriae NCTC 13129: DIP2172Help
Entry
DIP2172           CDS       T00151                                 

Definition
secreted glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DIP2172
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    DIP2172
Enzymes [BR:cdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     DIP2172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(2246580..2247743)
Genome map
AA seq 387 aa AA seqDB search
MDNLRRVFTPASLILGTVVAASMLSSCSQDSSQQAAPSTPSSTPTASQSEQSSSAMSATS
STPQAVALDPVQLRKDAASLMMVGVGNFDDALFAIQQGAGGIFIGSGTDPQILTTPGRDI
AELRRIAGRPLSVAIDFEGGRVLRHRGILGDFPSPQVMAQTMTPEQVRGMAYDMGRSLFA
HGINVNFAPVVDIEAGLEVVGDRAFSPDPLIDATYATAFAQGMADAGVRPVLKHFPGHGR
ASGDSHTAQVHTPPLAELEKLDLIPYGRVPVAGAGVMVGHMIVPGLGAPETPSTINPAAY
QLLRSGSYPGGQPFSGVIYTDDLTMGAVTSLMPTVQAVPAALAAGADQALWVSTAGLVEA
IDATVAAVSEGRYPVEQFKASVARVAG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggataacctacgccgcgttttcacacccgcctcgctgattcttggcaccgttgttgcc
gctagcatgctgagctcctgctcgcaggactcctcccaacaggctgcgccaagcactcct
tcatcaactcctactgcgtcgcagtctgagcagtcctcgtcggcaatgtcggcaacgtcg
tcaacgccgcaggctgttgctttagacccagtgcagctgcgcaaagatgctgccagcttg
atgatggtgggcgtgggcaatttcgacgatgccctctttgccatccagcaaggtgccggc
ggaatttttatcggctcgggtacagatccccagatcttgacaaccccaggccgcgacatt
gcggagctgcgtcgaatagcggggcgaccgctgtctgtagccatcgactttgagggtggg
cgcgtgttgcgtcaccgcgggatccttggcgatttcccatccccgcaggtgatggcgcaa
accatgaccccagagcaggtgcgcggaatggcttatgacatgggtcgttccttgttcgca
catggcattaatgtgaactttgcgccggtagtcgatattgaagccggccttgaagtagta
ggcgatcgcgcgtttagcccagatccgcttatcgacgccacctacgccaccgcattcgcc
caaggcatggcggatgctggggtgcgtcccgtactcaagcacttcccagggcatggccgc
gccagcggtgactcgcacaccgcacaagtacacaccccaccattggctgagctagaaaag
ctcgatctgatcccttatggccgagtgccggttgctggtgcgggcgtgatggttgggcac
atgatcgtgccaggtttgggtgcgccagaaaccccatcgacgatcaaccctgccgcatat
cagttgcttcgttccggttcgtatcccggtggtcaaccttttagtggcgtgatttacacc
gatgatttgaccatgggtgcggttacatcattaatgcccactgtgcaggcggtaccagca
gctctagcagcgggtgctgatcaggcactgtgggtaagtacagcgggcttggtcgaagcc
attgatgccactgtggctgcagtctcggaggggcgttaccccgtcgaacagttcaaggct
tcagttgcgcgagtcgcaggctaa

DBGET integrated database retrieval system