KEGG   Corynebacterium diphtheriae NCTC 13129: DIP2351Help
Entry
DIP2351           CDS       T00151                                 

Gene name
trpB1
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DIP2351 (trpB1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DIP2351 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DIP2351 (trpB1)
Enzymes [BR:cdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DIP2351 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2456701..2458032
Genome map
AA seq 443 aa AA seqDB search
MTDSTLRKTLISAYFGNYGGQFVPDALLPVLDELEQAYVDALNDPEFSRELARLQKHYLG
RPTPITECANLPLAGKGKGKVRIFLKREDLVHGGAHKGNQVLAQALIARRLGKTRLIAET
GAGQHGTATAMVAALMGMDCTIYMGAKDVARQQPNVYRMRLMGATVVPVTNEHGDSMSDA
IDVALMDWVENLDTTHYLIGSAVGPHPFPTLVKEFQAVISRESREQMLELTGKLPDAVVA
AVGGGSNAIGAFADYLTDKPGNESVRLIGVEPAGEGLDSGKHGAPLQRGKVGVQHGFKSF
ILADEQGNPLHSYSVSAGLDYPGVGPEHAHLMESGRAQYYGITDAEALQAFRMLSRYEGI
IPALESSHALAYALKMAENAEETDAPINIVVNLSGRGDKDVDYVRNILGDLATEDPATSP
VTDPHVAETLVTMIAESNAREGV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgactgactccaccctccgtaagacgttaatcagcgcctactttggtaactacggcgga
cagtttgttcccgatgcgctcctgccggttctcgacgaactagagcaggcctatgtggat
gcactcaacgacccagagttttcgcgggaacttgccaggctacaaaagcactaccttggt
cgtcccactcctattaccgaatgcgccaatcttcccctagcaggtaaggggaagggtaag
gtgcggatcttcctcaaacgcgaggatctagttcacggtggcgcacataagggcaatcag
gtgcttgcccaggcgttgattgctcgccgattgggtaaaactcgtttgatcgcagaaacc
ggtgctggtcagcacggtaccgccactgcaatggtggcggctttgatgggaatggactgc
accatttatatgggtgctaaagatgtggcccgccagcagcccaatgtgtatcgcatgcgg
ctcatgggggctacggtggtgccagtaaccaacgagcatggtgattccatgtcggatgct
atcgacgtagcgcttatggactgggtggaaaacttggataccacgcactatctgattggt
tctgcggtcggcccacatccgttccctacgctggtcaaggagtttcaggcggttatttcg
cgggaatctcgcgaacagatgctggagctaacaggcaagcttccggacgcagtagttgct
gccgtgggcggtggttcgaatgctattggtgcgtttgctgattatctcacggataagcca
ggtaatgagtccgtacgcttgattggtgtggagccagcaggcgaaggtcttgattccggt
aagcatggtgcgccgctgcagcgtggcaaggttggtgtgcaacacggcttcaagtcgttc
atcttggctgatgagcagggcaatccgctgcattcttattccgtatcggctggtcttgat
tatccaggcgtgggtccagaacacgcccacctcatggaatctggtcgtgcgcaatattat
ggaatcaccgatgccgaggcgcttcaagcattccggatgctgagccgctacgagggtatc
attccagctttggagtctagccacgctctagcatatgcgttaaagatggcagaaaacgcc
gaagaaaccgatgctcccattaacattgtggtcaatctttcgggtcgtggcgataaagat
gtggactatgttcgtaatatcttgggcgatcttgctaccgaggatccagcaacctcacca
gtcacggatcctcatgtcgccgaaaccctcgtcacaatgatcgctgagtccaatgcacga
gagggagtctaa

DBGET integrated database retrieval system