KEGG   Corynebacterium diphtheriae NCTC 13129: DIP2355Help
Entry
DIP2355           CDS       T00151                                 

Gene name
trpC1
Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase (EC:4.1.1.48 5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cdi01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cdi00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2461262..2462719
Genome map
AA seq 485 aa AA seqDB search
MQNDSSTRPMPTVLESIVSGRRSHLPEIQARISHVDPARLLRSTRSLFQSLGGRSDGGPA
LRGSARFIMECKSSSPSLGMIREDYRPGDIARVYSRYAAGISVLCEPDRFGGDYNHLATV
AATTHLPVLCKDFIIHPAQVHAARYFGADAILLMLSVLDDATYTELSQEAARLGLDVLTE
VIDEVEVERAIRLGATIFGINHRNLHDLSIDLNRSARLAQLIPDSAVIVSESGIRNNETV
RQLSGHSSAFLVGSQLTSQPDVDRAARELVYGLNKVCGLQSPSEAQAARASGAIYGGLIF
VESSPRNVSRETSKKIMAAEPDLTYVAVSRRTTGWTEIIGGNIAVAQIHSPYQGSIAAEK
ELINHVRGEVGDKVKIWRAVSMTHADGSLVAEALAPEVDRLILDTGNGGTGTTFDWARIP
EAVKGKTLLAGGIGPDNVTEALAVGCAGPDLNSGLEYPVEAGKWAAHKDATAIHSTFTQI
RGFHY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatgattcgtcgacacgccccatgcccaccgtcctagaatccatcgtttcgggc
cgacgatcccacctgcccgaaatccaagcgcggatttcccacgtggacccggcgcgacta
ctgcgttccacccgctcgctgtttcagtcgttgggaggccgtagcgatggcggtccggcg
ttgcgggggagtgcgcgctttatcatggagtgtaagtcctcttcgccatcgcttggcatg
attcgtgaggattatcgccctggcgacatcgcgcgggtgtattcacgttatgcggccggc
atttcggtgttgtgcgagccggatcgttttggcggcgactataaccatctggccacggtg
gcggccacgacacatctgccggtgctgtgcaaggattttattatccaccccgcacaggtt
cacgcggcacgttattttggggcggacgcaattttgctcatgttgagtgtgcttgacgac
gccacctacaccgagctcagccaggaagcagcacgcttggggttggatgttctcaccgag
gttatcgacgaggttgaggtggaacgtgccattcggttgggggccacaatctttggcatt
aatcatcgcaatctgcatgacttgagcattgatttaaatcgctcagcacgccttgcgcag
ctgattcccgatagcgccgtgattgtctccgagtctggcattcggaataacgagacggtt
cgccaactcagcgggcattccagcgcattcttggtaggctcgcagcttacttctcagcca
gatgtggaccgtgcggcccgcgagcttgtgtacggcctcaataaggtgtgcggtttgcag
tcaccaagcgaggcgcaagcagcgcgcgcatcgggcgcaatctatggcggattaatcttc
gtggagtctagtccgcgtaatgtttcacgtgaaacatcgaaaaaaatcatggctgccgaa
cctgacctcacctatgtcgccgtctcacgacgcaccaccggatggaccgaaattataggt
ggcaacatcgccgttgctcagatccacagtccttaccagggctccatcgccgccgaaaaa
gaactcattaaccatgtgcgcggcgaggtaggagacaaggtaaaaatctggcgtgcagtc
tccatgacgcatgccgacggctcccttgtcgccgaagcactcgcacccgaggtagacaga
ctcatcctcgacaccggcaacggcggaaccggcaccaccttcgattgggcacgcatccca
gaagccgtaaagggcaagactcttctcgccggcggcattggaccagacaatgtcaccgag
gcactcgccgttggctgcgcgggacccgatctcaactccgggttggaatatccagtcgaa
gcagggaagtgggcagcacacaaagacgctactgcaatccactccactttcacccaaata
cgtggttttcattactaa

DBGET integrated database retrieval system