KEGG   Corynebacterium diphtheriae NCTC 13129: DIP2360Help
Entry
DIP2360           CDS       T00151                                 

Gene name
trpB2
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cdi01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cdi00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cdi00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2465139..2466365
Genome map
AA seq 408 aa AA seqDB search
MKHTLLPAYFGEFGGQYVPESLIPALDQLEAAFVEAQNDPEFRAELAGYLKDYLGRPTPL
TLCSKLPKAGKGKGHARIFLKREDLVHGGAHKTNQVIGQALLAKRMGKTRIIAETGAGQH
GTATALACALLDLDCVIYMGAKDVERQQPNVYRMELMGAKVVPVDSGSGTLKDAVNEALR
DWTATFHESHYLLGTAAGPHPFPTIVREFHRVISEEAKAQILEQTGALPDVVVACVGGGS
NAIGMFADFIDDPSVELVGAEPGGMGLSSGKHGATINNGQIGILHGARSYLMRNSDGQVE
ESYSISAGLDYPGVGPQHAHLAKSGRARYVAITDAEALEAFQLLSREEGIIPALESSHAL
AYALKRAALAEENNEDITIVVSLSGRGDKDIDHIRRTLSAHPELVVKD
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacacactgctaccggcatacttcggagaattcggcggacaatacgtacccgag
tcccttatccccgccctcgaccaattagaagcggccttcgtggaagcgcaaaacgatccc
gagtttagagccgaactcgccggctacctcaaggactacctcggtcgtcccacgccgctc
acgctctgctccaagctacccaaagccggaaaagggaaggggcacgcgcggatcttcctc
aaacgagaagacctcgttcacggcggcgcacacaaaaccaaccaagtaatcggccaagcc
ctcttagccaaacgcatgggtaaaacccgcattattgctgaaaccggtgccggacaacac
ggaaccgccaccgcactcgcatgcgcactgctcgacctcgactgcgtgatctacatgggc
gctaaagacgtggaacgccaacaacccaacgtgtaccgcatggagctcatgggcgccaag
gtcgtaccagtcgactccggctccggaaccctcaaagatgcagtcaacgaagcactgcgc
gattggaccgcaaccttccacgagtcacactatctgctcggcaccgcagccgggccacac
ccatttcccacgattgtgcgcgaattccaccgcgtaatctcagaagaagccaaagcccaa
atacttgagcaaaccggcgcactgccagatgtggtggtcgcctgcgtcggcggcggatcc
aacgctatcggcatgttcgccgactttatcgacgacccctcagtagaactcgtcggtgca
gaaccaggcggcatgggactaagctccggaaaacacggcgctaccatcaacaacggccaa
atcggtattttgcacggcgccagaagctacctcatgcgcaactccgatggccaagtagag
gaatcctattccatttcagccggcctcgactacccaggtgtcggcccacaacacgcccat
ctagcaaagtctgggcgcgcccgctatgtcgccatcactgatgcggaagcactcgaagca
ttccaattgctctcccgcgaagagggcatcatcccggccttggaatccagccacgctctt
gcttatgcactcaaacgtgccgccctcgctgaggaaaacaacgaagatatcaccatcgtg
gtgtccttgtctggccgtggcgacaaagacatcgaccacatccgccgcactctttccgcc
cacccagagctggttgtaaaggactaa

DBGET integrated database retrieval system