KEGG   Corynebacterium diphtheriae NCTC 13129: DIP2361Help
Entry
DIP2361           CDS       T00151                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DIP2361 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DIP2361 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DIP2361 (trpA)
Enzymes [BR:cdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DIP2361 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2466370..2467206
Genome map
AA seq 278 aa AA seqDB search
MTRYTKLFSALSAKNEGAFVPFIMLGAPTPEASLAIIRTVVAAGADALELGVPFSDPVAD
GPTIQRSHLRALDNGATVDSSLELIRQIRKEFPELPIGMLIYGNVAFTRGITQFYQEFAD
AGVDSILLPDVPVREGEPFIAAAKQAGIDPIFIAPAQASEATLEGVAQHSSGYIYAISRD
GVTGTERQSSTRGLDKVVANVKRFGGAPILLGFGISTPEHVRDAIAAGASGAITGSALTS
IIERHTTGTHPEPAQVTDLEALTEEIFAFVKDMKAATR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgactcgctacaccaaattattctccgcactcagcgccaaaaacgaaggtgcattcgtc
cccttcatcatgctgggtgctcccaccccagaggcgtcgttagcaatcatccgtaccgtc
gttgccgcgggtgccgacgccctcgaactcggcgtccccttctccgacccagtagcagac
ggccccacaatccaacgctcccacctccgtgccctcgacaacggagccaccgtcgatagc
tcgctggaactgatccgacagatccgcaaagaattccccgaacttcccatcggcatgctc
atctacggcaacgttgccttcacccgcgggatcacccagttctatcaagaattcgccgac
gccggcgtagactccatcctgcttcccgacgtccctgtccgcgaaggcgagcctttcatc
gcagccgccaagcaagctggaatcgaccccatcttcatcgcccccgcacaagcctcggaa
gcaaccttggaaggggtagcgcaacactccagcggatacatctacgctatctcccgcgat
ggtgtgaccggaaccgaacgccaatcctctactaggggactagacaaagtggtggcaaat
gtgaaacgtttcggcggcgcaccgatcctgctcggttttggtatctccactcccgagcat
gtgcgcgacgccatcgcggcaggagccagcggcgccattacaggctccgcgctgacgtcg
atcatcgagcggcacaccacaggcacacacccagagccagcccaagtgacagaccttgag
gctctcaccgaagaaattttcgcgttcgttaaagacatgaaagccgcaacccgttaa

DBGET integrated database retrieval system