KEGG   Camelus dromedarius (Arabian camel): 105090112Help
Entry
105090112         CDS       T04642                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
Glycerolipid metabolism
Metabolic pathways
Thermogenesis
Retrograde endocannabinoid signaling
Regulation of lipolysis in adipocytes
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:cdk00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    105090112 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    105090112 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    105090112 (MGLL)
  Environmental adaptation
   04714 Thermogenesis
    105090112 (MGLL)
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     105090112 (MGLL)
Peptidases [BR:cdk01002]
 Serine Peptidases
  Family S33
   105090112 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 303 aa AA seqDB search
MPEESSPRRTPQSVPYRELPHLVNADGQYLFCRYWKPSGTPRALVFVSHGAGEHCGRYDE
LARMLVGLGLLVFAHDHVGHGQSEGERMVVSDFQVFIRDVLQHVDLVQKDHPGLPVFLLG
HSMGGAIAILTAADRPGHFSGMILISPLVLANPESATTFKVLAAKVLNLVLPNMSLGPID
SSMLSRNKAEVDLYNTDPLICRAGLKVCFGIQLLNAVSRVERALPKLTLPFLLLQGSADR
LCDSRGAYLLMESAKSQDKTLKIYEGAYHVLHKELPEVTNSVFREINTWVSQRTVVAGTG
SPP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggaaagttctcccagacggaccccgcaaagcgttccctatcgggagctccct
cacctggtgaatgctgacggacagtacctcttctgcaggtactggaaaccctcgggcaca
cccagggccctggtttttgtgtcccatggagccggggagcattgcggccgctatgatgag
ctggctcggatgctggtgggcctggggctgctcgtgtttgcccacgaccacgtcggccac
gggcagagcgagggggagaggatggtcgtgtctgacttccaggtcttcatcagggatgtg
ttgcaacacgtggacctggtgcagaaggaccaccccgggcttccggtcttccttctgggc
cactccatgggaggggccattgccatcctgacggccgcggacaggccgggccacttctcc
ggcatgattctgatttccccgctggttctcgccaaccccgagtccgcaacaaccttcaag
gtccttgctgcgaaagttctcaaccttgtcctgccaaacatgtccctgggcccgattgac
tccagcatgctctcgcggaataaggcagaggtggacctctacaacacggaccccctcatc
tgccgggcggggctcaaagtgtgctttggcatccagctgctcaacgccgtgtcgcgggtg
gagcgggccctccccaagctgaccctgcccttcctgctgctgcagggctctgccgaccgc
ctgtgcgacagcagaggggcctacctgctcatggagtccgccaagagccaggacaagacg
cttaagatttacgaaggtgcctaccacgtcctccacaaagagcttcctgaagtaaccaac
tctgtcttccgtgagataaacacgtgggtctctcaaaggacagtggtggcgggaacaggg
tccccaccctga

DBGET integrated database retrieval system