KEGG   Clostridioides difficile R20291: CDR20291_0007Help
Entry
CDR20291_0007     CDS       T00998                                 

Gene name
recD
Definition
(GenBank) recombination protein
  KO
K06187  recombination protein RecR
Organism
cdl  Clostridioides difficile R20291
Pathway
cdl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cdl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CDR20291_0007 (recD)
DNA repair and recombination proteins [BR:cdl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     CDR20291_0007 (recD)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CDR20291_0007 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 IMS_HHH HHH_8 Cdd1
Motif
Other DBs
NCBI-ProteinID: CBE01475
UniProt: C9YHG6
Position
22289..22888
Genome map
AA seq 199 aa AA seqDB search
MQVYTGPITRLIEEFSKLPGVGRKTAQRLAFHIINMNTNDVEALSKAIIDAKREIRYCSI
CCNITDTDPCSMCSNKSRDSSVICVVEDPRDVAAMERTREFKGQYHVLNGVISPMDGIGP
DMLKIKELIQRLGNQEVKEIIMATNPTIEGEATAMYIARLVKPMGIKVTRIAHGLPVGGD
LEYADEVTISKALEGRREI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtttatacaggtcccataacgagacttatagaggaattttcaaagcttcctgga
gtaggaagaaagactgctcaaagattggcttttcatattattaatatgaatactaatgat
gtggaagctttatctaaagcgattatagatgcaaaaagagaaataagatattgctcaatt
tgttgtaatataacagatacagacccatgtagcatgtgttcaaataaaagtagagattca
agtgttatatgtgttgtggaagatccaagagatgtagcagctatggagagaacgagagag
tttaaaggacagtatcatgtattaaatggagtaatttctccaatggatggaattggacca
gatatgttaaaaataaaggaacttatccaaagacttggcaatcaggaagtcaaagaaata
ataatggcaacaaatcctactattgaaggtgaagcgacagccatgtatattgctaggtta
gtaaaaccaatgggaatcaaagtcactcggatagctcatggtcttcctgttggaggcgat
ttagagtatgcagatgaggtcacaatatcaaaagcactagaaggcagaagagaaatataa

DBGET integrated database retrieval system