KEGG   Clostridioides difficile R20291: CDR20291_0027Help
Entry
CDR20291_0027     CDS       T00998                                 

Gene name
acoC
Definition
(GenBank) E2 component of acetoin dehydrogenase enzyme system (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cdl  Clostridioides difficile R20291
Pathway
cdl00010  Glycolysis / Gluconeogenesis
cdl00020  Citrate cycle (TCA cycle)
cdl00620  Pyruvate metabolism
cdl01100  Metabolic pathways
cdl01110  Biosynthesis of secondary metabolites
cdl01120  Microbial metabolism in diverse environments
cdl01130  Biosynthesis of antibiotics
cdl01200  Carbon metabolism
Module
cdl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cdl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDR20291_0027 (acoC)
   00020 Citrate cycle (TCA cycle)
    CDR20291_0027 (acoC)
   00620 Pyruvate metabolism
    CDR20291_0027 (acoC)
Enzymes [BR:cdl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CDR20291_0027 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding AATase CAT
Motif
Other DBs
NCBI-ProteinID: CBE01510
UniProt: C9YHI6
Position
60235..61281
Genome map
AA seq 348 aa AA seqDB search
MVANKIKATPAARSQARKDNIKLDRLIGSGENGRIHLVDVLNYLKDNKANTTPLARRIAE
DLNIDLETIVGTGYSGKIRKCDVEKLTAKETIVSNNTSKYSEKKELKIENENSSMFNTVE
GIFEKPNPMRATVAKRMSESYFSAPVFTFNIEVDATELKVLRAKLIDTVKESTGVKLTMT
DLIVMAVSKILPNHQALNSAWTDEGIFRYKDVNIAIAVGLDEGLYVPVVKNANKKSLKEI
AKESKELAEKVKTGKLMPADQEGNTFTISNVGMYGITTFTPIINMPSSAILGVGATQDKF
VPVNGEAKIKPIMNLSLTSDHRVIDGTVAAKFLKDLKELLENPLSMLV
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggtggcaaataaaataaaagccacaccagcagctagaagtcaggcaagaaaagacaat
ataaaattagataggctgattggaagtggagaaaatggaaggattcatttagtagatgtg
ttaaattatttaaaagataataaagcaaatactactcctttagctagaagaatagcagaa
gatttaaatatagatttagaaactattgtaggtactggatatagtggaaagataagaaag
tgtgatgtggaaaaattaactgcaaaagaaactattgtatcaaataatacatctaaatat
agtgagaaaaaagagctgaaaattgaaaatgaaaattcaagcatgtttaacacagtagaa
ggaatatttgaaaagccaaatccaatgagagctactgtagcaaaacgaatgtcagaaagt
tattttagtgctcctgtatttacattcaatatagaagtagatgctacagaattgaaggta
cttagagcaaagttaatcgacacagtaaaagaatcaactggagtaaaattaactatgaca
gatttaatagtaatggcagtatctaaaatacttccaaatcatcaagccttaaattcagca
tggacagatgagggtatatttagatataaagatgtaaatatagctattgcagttggttta
gatgaaggcttatatgttccggtagtaaaaaatgcaaacaaaaagtctttaaaagaaata
gcaaaagaaagcaaagaacttgcggaaaaagtaaagacagggaaacttatgccagcagac
caagaaggtaatacatttacaataagtaatgttggaatgtatggtataactacatttaca
cctataataaatatgccttcaagtgcaatcttaggggtaggtgctacacaagataagttt
gttccagtaaatggagaggctaaaataaaacctataatgaacttatcattaacatcagac
catagagtaatagatggaacagtagctgcaaaattcttaaaagatttaaaagaattgtta
gaaaatcctttatcaatgcttgtatag

DBGET integrated database retrieval system