KEGG   Clostridium difficile R20291: CDR20291_0131Help
Entry
CDR20291_0131     CDS       T00998                                 

Definition
DNA-binding protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cdl  Clostridium difficile R20291
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cdl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
172790..175009
Genome map
AA seq 739 aa AA seqDB search
MEKLEGMISEIVFKNEDNGYTIAHLVNENDEIVVVGCMPTLAIGESIEVEGKWVNHKIYG
TQFEVNSFMPVTPSSLEGIYVYLSSGMIHGIGEKMAKRIIDKFGVDTLEVIQNSPEKLQE
VEGIGSKKVKQIVKSYEEDRELRNIIIQLSPFGITPNYCLKIYKKYKSSAIEVINKNPYQ
LAEDIRGIGFKVADSIASKIGIDKNSKDRICQGILYTLNKSLSNGHTYLPEHVLIQDSEK
LLELNGEIIKECVMMLVYNQKIHIEKVNNENLIYLMPYYLAENGVCSQIVKLSQYEFEDL
KIDIDNEINVLEEDKKIKLAEKQILAVKESVNSGVLIITGGPGTGKTTTINAIIDIFENN
GKSVTLAAPTGRAAKRMSETSNKEAKTIHRLLEMGFSTDDDLTFFKDEEDPINSDVIIVD
EVSMVDIILMYNLLRAIKLGTRVILVGDSDQLPSVGAGNVLKDMINSNIINVVKLNEIFR
QAQESMIIVNAHKINNGEPLYLNTKGKDFFFIRKSTNEEILNEIIGLVNERLPKFYKVDK
LKDIQVLSSMRKGELGVTNLNIELQKYLNKKEKFKVEESFSKRLFRVGDKVMQVKNNYTK
KWETEDQKESGEGIYNGDIGYVYHIDKDKKTIYILFDQTKIVSYLYDELDEIDHSFCTTI
HKSQGSEFPVVVLPIAWAPPMLLSRNLLYTAVTRAKKLVVLVGDVKYLEYMIKNNRVNQR
YSNLGYKLNKFKQEGLLIE
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattagaaggaatgataagtgaaatagtctttaaaaacgaagataatggttat
acaatagctcacctggtaaatgaaaatgatgaaattgtggttgtaggatgtatgcctact
ttggcaattggagaaagcatagaagttgaaggaaagtgggtaaatcataagatttatggg
actcaatttgaagtgaatagttttatgccagtaacgccatcatccttagaaggaatttat
gtttacttatcttctggaatgatacatggtattggtgaaaaaatggcaaaaagaataatt
gataagtttggtgtagatacgttagaggtgatacaaaattcaccagaaaaattacaagaa
gtagaaggtatagggagtaaaaaagtaaaacaaatagtaaaaagttatgaagaagacaga
gaattgagaaatataataatacagctatctccttttggaataacaccaaattactgccta
aaaatatataaaaaatataaaagcagtgcaatagaagttataaataaaaacccataccaa
cttgctgaagatataagaggaattggatttaaagtagctgatagtatagcaagtaaaatt
ggtatagataaaaactctaaagatagaatttgtcagggaatcttatacactttaaataaa
tctttaagtaatgggcatacatatttaccagagcatgttctaatacaagattcggaaaaa
ttattggagctaaatggagaaataataaaagagtgtgtaatgatgctagtttataatcaa
aaaatacatatagagaaagtaaacaatgaaaatcttatataccttatgccatactattta
gctgaaaatggagtatgtagtcaaatagtaaaattatcacagtatgaatttgaagactta
aaaatagatatagataacgagattaatgttttagaagaagataagaaaattaagttagca
gaaaaacaaattttagcagtcaaagaatctgttaatagtggagtattaattataactggt
ggaccaggaactggtaaaacaactaccattaatgctatcatagatatatttgaaaataat
ggtaaaagtgtgactttggcagctccaacgggaagagcagcaaagagaatgagtgaaact
tctaataaagaagcaaaaactatacataggttgctagaaatgggattttcaacagatgat
gatttaactttttttaaggatgaagaagacccaataaattcagatgtaataattgttgat
gaggtatcaatggtagacattatcttaatgtacaatttacttagagctataaagttagga
acaagagtaattttagttggagatagtgaccaattaccttctgtaggtgctggaaatgta
cttaaggatatgattaattctaatattataaatgtagttaaattaaatgaaatatttaga
caagcgcaagaaagtatgataattgtaaatgcccataagataaacaatggagaaccactt
tatctaaatacaaaaggtaaagatttcttttttataagaaaatcaactaatgaagaaatt
ttaaatgaaataataggattggttaatgaaagattacctaaattttataaagttgataaa
ttaaaagatatacaagttttatcttcaatgagaaaaggtgaattgggagttactaatctc
aatatagagttacagaagtatcttaacaaaaaagaaaaatttaaagttgaagaaagtttt
tctaaaagattatttagagttggcgataaggtaatgcaagtaaaaaataattatacaaaa
aaatgggaaacagaagaccaaaaagaaagtggagaaggtatctataatggagatatagga
tatgtttatcacatagataaagataagaaaactatttatatattatttgaccagactaaa
attgtatcatacctatatgatgaattagatgaaattgaccatagtttttgtacaacaata
cataaaagccagggaagtgaatttccagttgtagtattgccaatagcgtgggctcctcct
atgttacttagccgtaatttattatatacagcagtaacaagagcaaaaaaattagttgta
ttagttggagatgtgaaatatcttgaatatatgataaaaaataatagagttaatcaaagg
tattcaaatttaggatataagctaaataaatttaaacaagaagggttgttgatagaataa

DBGET integrated database retrieval system