KEGG   Clostridium difficile R20291: CDR20291_0185Help
Entry
CDR20291_0185     CDS       T00998                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic chain
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cdl  Clostridium difficile R20291
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cdl00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cdl00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
238152..239072
Genome map
AA seq 306 aa AA seqDB search
MLKSRNLIQPEDFSIEEIDEILELAQKIIDNPSKYSRICEGKLLATLFYEPSTRTRLSFE
SAMNRLGGRVVGFSEPNSSSASKGETLGDTMRIVSGYVDIIAMRHPQSGAASEAARYTEV
PFINAGDGKNQHPTQTLTDLLTIKSLKGTLESHTIGLCGDLKYGRTVHSLVKAMARYKNT
KFVFIAPEELKMPDYIKEAIKGHAYYETNNLDDVIGSLDVLYMTRVQQERFEDKSEYERL
KNYYILNKAKLEKASKDMLVMHPLPRVNEIDIDVDSDDRAVYFKQAKYGMYVRMALIIKL
LGINED
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaatcaagaaatttaatccaaccagaagacttttcaatagaagaaatagatgaa
atattagaattagctcaaaaaataattgacaatccgtcaaaatattctcgtatatgtgaa
ggaaaactattagctacattattttatgaaccatcaacaagaacaagattaagctttgaa
tctgctatgaacagattaggaggacgtgtagtaggcttttcagagccaaattcatcctct
gcatcaaaaggtgaaactctaggagatacaatgaggatagtatctggttatgttgatata
atagctatgagacatcctcaatcaggtgcagcttcagaagcagctagatatacggaagtg
ccatttataaatgcaggagacggcaaaaaccagcatccaactcaaacacttacagactta
cttactataaaatcattaaaaggaactttagaaagccatacaataggattatgtggtgat
ttaaaatatggaagaactgtgcattctttggttaaggctatggcaagatataaaaataca
aagtttgtatttatagcgcctgaagagttaaaaatgccagattatataaaagaagctata
aagggacatgcatattatgaaactaataatttggatgatgttataggaagcttggatgtt
ttatatatgactagagttcaacaagaaaggtttgaagataaatcagagtatgaaagactt
aaaaactattatattttaaataaagctaaattagaaaaggcatctaaagatatgttagta
atgcatccattaccaagagtaaatgaaatagacatagatgtagatagtgatgatagagct
gtatattttaaacaagctaaatatggaatgtatgttagaatggctttaataataaaactt
ttaggtataaatgaagactaa

DBGET integrated database retrieval system