KEGG   Peptoclostridium difficile R20291: CDR20291_0225Help
Entry
CDR20291_0225     CDS       T00998                                 

Definition
dtdp-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cdl  Peptoclostridium difficile R20291
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CDR20291_0225
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CDR20291_0225
Enzymes [BR:cdl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     CDR20291_0225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
286058..286615
Genome map
AA seq 185 aa AA seqDB search
MGKINVIKTKIEGLYIVEPNVFCDERGYFMESYNKKDFIEQGLDMCFIQDNESSSRKGVL
RGMHFQVRYPQGKLVRVTEGEVFDVAVDLRKDSQTFGKWEGVILSDKNKKQFYIPEGFAH
GFLVLSEKAVFNYKCTNYYYPEFEHGFIWNDKQISIEWPLKGIEEIFLSEKDKKQKSFKD
ICIRR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaatcaatgttataaagactaaaatagaaggattatatatagtcgaaccaaat
gtattttgtgatgaaagaggatattttatggaaagctataataaaaaggattttatagag
cagggtcttgatatgtgttttattcaagataatgagtctagctcaagaaaaggtgtttta
agaggaatgcattttcaggttagatatcctcaaggaaaattagtcagagttacagaggga
gaagttttcgatgttgcagttgatttaagaaaagattcacagacatttgggaaatgggaa
ggtgtaatattgtctgataagaataaaaaacaattttatattccagaagggtttgcacat
ggatttttagttttatcagaaaaagcagtatttaattacaaatgtacaaactattattat
ccagaatttgagcatgggtttatatggaatgacaagcaaatatctattgagtggccttta
aaaggaattgaagaaatatttttatcagaaaaggacaaaaaacaaaaaagttttaaagat
atttgtataagacgttaa

DBGET integrated database retrieval system