KEGG   Peptoclostridium difficile R20291: CDR20291_0294Help
Entry
CDR20291_0294     CDS       T00998                                 

Definition
peptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cdl  Peptoclostridium difficile R20291
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:cdl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CDR20291_0294
  Amino acid metabolism
   00300 Lysine biosynthesis
    CDR20291_0294
Enzymes [BR:cdl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     CDR20291_0294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
348600..349907
Genome map
AA seq 435 aa AA seqDB search
MDISRSVDNSLNRTIEFLKELIKIDSQQGEPISQCPFGIGPKKSLDKTLDYCASLGFSVK
NIDNYIGYAEIGEGEELIGIPMHLDIVPPGEGWSVDPFSGAVIDNIIYGRGVIDNKGAVS
MLIHVLKNIEDMYPTINKRIRLIFGTNEETDMKCIKYYLDKGEEIPSMGFTPDAMYPVVN
GEKGRVHIRIEKEIKIDKSKPYIIVRGGTKENVVPSHCTAKIINGIISELTTKGVAVHAS
NPEKGENAISKMVIKIVEDNMDFQHREDIELVSKYLCSDYYGDALGINQYDEVFKNTTLN
LGILKVNEEKIVCELDIRYGKNIVLNNIIDRFKKVFCNGWKIEVIAHKDLHYVDESNLVL
KKLLEAYEEVTDENGYTIAMGGGTYASWFKDMVAFGPKFLAYKTGGHGVDERVPINHIRK
NMEIYTLALIKLLEL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggatataagcagaagtgtagataatagtttaaatagaaccatagaatttctaaaagaa
ttgataaaaattgattcacaacaaggtgaacctatttcacaatgtccttttggtatagga
cctaaaaaatctttagataaaactttagattactgtgctagtttaggttttagtgttaaa
aatattgataattatattggatatgcagaaattggagagggagaggaattaatagggatt
ccaatgcatttagatatagttccaccaggagaggggtggagtgtagacccattttcggga
gcagtaattgacaatattatttatggaagaggtgtcatagataataagggtgctgtatct
atgcttatacatgtattgaaaaacatagaggatatgtatcctacaattaataaaagaata
agattaatttttggtacaaatgaggagacagatatgaaatgtatcaaatattacttagat
aaaggtgaagaaattccaagtatgggatttactccagatgctatgtatccagtggttaat
ggagaaaaaggaagggttcatataaggatagaaaaagaaattaaaattgacaaaagtaaa
ccttacataatagtaaggggaggaactaaagaaaatgttgttccatctcattgtactgca
aaaattattaatggaattatttcagagttaactactaaaggagtagctgtacatgcaagt
aatcctgaaaagggagaaaatgctatatctaaaatggtaataaagatagttgaggataat
atggattttcagcatagagaagatatagaattagtttcaaaatacctttgtagtgattat
tatggagatgcattggggattaatcaatatgatgaggtattcaaaaacactaccttaaat
ttaggaatattaaaagtaaatgaggaaaaaatcgtatgtgagttagatataaggtatggt
aaaaatatagttttaaataacataatagatagattcaaaaaggttttttgtaatggttgg
aaaatagaggttattgctcataaagacttacattatgtggatgagagtaatttagtactt
aaaaaattattagaagcctatgaagaagtaacagatgaaaatggatatacaattgctatg
ggtggtggcacatatgcaagttggtttaaagatatggtggcgtttggacctaagttctta
gcgtataaaactggtggtcatggagtagatgaaagagtaccaataaatcatatacgaaag
aatatggagatatatactttggctttaataaaactattagaattgtaa

DBGET integrated database retrieval system