KEGG   Peptoclostridium difficile R20291: CDR20291_0669Help
Entry
CDR20291_0669     CDS       T00998                                 

Gene name
glpK1
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cdl  Peptoclostridium difficile R20291
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CDR20291_0669 (glpK1)
Enzymes [BR:cdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CDR20291_0669 (glpK1)
Exosome [BR:cdl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CDR20291_0669 (glpK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
827782..829308
Genome map
AA seq 508 aa AA seqDB search
MKYVLAIDQGTTGTRAVLINEKSEFVFSDYMEHTQIYPQSGYVEHDPIEIWNNTKTVSNN
VLQQAFESGINESDIKGIGIDNQGETVMLWDKNTGKPLYNAIVWQCRRTYDYVENLKNIP
GLENKIIDKTGLIIDPYFSGTKIKWVIDNVKGVKEKIKNGEVLAGTLDSWLIWKMTGGKS
FLTDVSTAARTMLFNIRDMDWDRELLDIIGVPRSILADIMPTSGDFGTTDKEAFCGVSIK
ITASMVDQPAALFGNGCFEPGMVKNTYGTGCFLYMNIGEELNIAGNGILTTVAWKIGDKV
TYAYDGGVYIAGAAIQWLRDGIGVIKNYSETDDMANSISSTGGVYFVPAFAGIAAPYWDQ
YARGTMVGITGSTKKEHIVRATLESVALQVKDVVDSMNLASGKEIKMLRVDGGITKNNFT
MQFQSDILDIPIEIAENPETTVLGVGYMAGLSCGVWNSIDEIRSEFTISKKYIPNMTKQK
REEILLGWNQAVKRAMNWENDTKKVCAN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatatgtattagcaattgaccaaggaacaacaggaacaagagcagtattgataaac
gaaaaatcagagtttgtttttagcgattatatggaacatactcaaatatatccacaatct
ggatatgttgaacatgaccctatagaaatttggaataatacaaaaactgtgagtaataat
gtattacaacaggcttttgaaagtggaatcaatgaaagtgatataaaaggaattggtata
gataatcaaggtgaaacagtaatgttatgggataaaaatacaggtaaaccactttacaat
gctatcgtatggcagtgtaggagaacttatgattatgtggaaaatttaaagaatatacca
ggtttagaaaataagataatagataagactgggttaattatagacccatatttctcaggt
acaaaaattaaatgggtaatagataatgtaaaaggtgtaaaagaaaaaattaaaaatgga
gaagtacttgcaggaacattggatagttggttaatatggaaaatgacaggaggaaaatct
tttttaactgatgtatctacagcagcaagaacaatgctttttaatataagagatatggat
tgggatagagagttgcttgacattataggagtgcctagaagtattttagcagatataatg
cctactagtggtgattttggaactacagataaggaggcattttgtggggtttctataaaa
attactgcttcaatggtagaccaaccagcagctttatttggcaatggatgttttgaacca
ggaatggttaaaaatacttatggtacaggatgtttcttatatatgaatataggtgaggag
ttaaatatagcaggtaatggtattttgacaacagttgcttggaagataggagataaagtt
acatatgcttatgatggtggagtgtatatagcaggtgctgcaatacaatggcttagagat
ggaattggagttataaaaaattattcagaaactgatgacatggcaaattccatatcaagt
actggaggggtatattttgtaccagcatttgcaggtatagcagcaccttattgggaccaa
tatgctagaggcacaatggttgggataacaggaagtactaaaaaagaacatatagtaagg
gctactcttgagtctgttgcacttcaagtcaaggatgttgttgattccatgaatttggct
tcagggaaagaaataaaaatgttgagagtagatggtggaattactaaaaataactttaca
atgcaatttcaatctgacatattagatataccaattgaaattgcagaaaatcctgaaacg
acagtacttggtgtagggtatatggcagggctttcctgtggtgtttggaacagtattgat
gaaattagaagtgaatttacaataagcaaaaaatatattccaaatatgactaagcaaaaa
agagaagaaatattacttggatggaatcaagcagtaaaaagagctatgaattgggaaaac
gataccaaaaaggtgtgtgctaattaa

DBGET integrated database retrieval system