KEGG   Peptoclostridium difficile R20291: CDR20291_0748Help
Entry
CDR20291_0748     CDS       T00998                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cdl  Peptoclostridium difficile R20291
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:cdl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDR20291_0748
Enzymes [BR:cdl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     CDR20291_0748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
918085..919491
Genome map
AA seq 468 aa AA seqDB search
MNTGFPKDFLWGASSSAFQVEGAWDKDNKGKTVADYNSFKKSHLQADTKVASDFYHNYEE
DIELMKELGMKTYRFSISWARIIPDGEGEINQKGLDFYNKIIDKLIECDIEPFVTLYHFD
LPFKLVEKYNGWESRETVYAFERFAKICFKHFGDRVKYWQPHNEQNLIVRVEERINIYDE
TDSWKIDKMRAQMDYNLCLAHALAVNACHEMIKESKIGAAVSSSVTYPLTSKPEDVYAAR
MNDNFKVYYMLDMHHYGEYPGYYMKYLEKRNTVPHMEDGDKEILKKAKMDFIAVNYYRTN
CAEALPEDSQHPFGLREGTVDFSMYGLFKMSMNPNLEASEYGAAIDPSGLRVALNEYWQR
YHLPVIITENGLGAKDILEDGKIHDDYRIDYLRSHINACKLAIEDGVEMIGYCPWSFTDL
LSSSQGFNKRYGLVYINRTDHEVLDLKRIKKDSFYWYKEVIENNGIVK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaggatttccaaaagactttttatggggagcatcatcttctgcatttcaagtg
gaaggagcttgggataaagacaataaaggaaaaaccgtagccgactataattcttttaaa
aagtctcatttacaggcagatactaaagttgcatcagacttttaccataattatgaagaa
gatattgaattaatgaaagaattagggatgaaaacatatcgtttttcaatttcatgggca
aggataataccagatggtgaaggagagataaaccagaaaggtttagacttttataataag
ataatagacaaactaatagagtgtgatattgagccattcgtaactttataccattttgac
cttccatttaaattagtagagaaatataatggttgggaaagtagagaaactgtctatgct
tttgaaagatttgctaaaatatgctttaagcattttggagatagggtaaagtattggcaa
cctcataatgaacagaatttaattgttagagtggaggagagaattaatatatatgatgaa
acagattcatggaagatagataaaatgcgtgctcagatggattataatctttgcttagca
catgcattagcagtcaatgcatgtcatgagatgataaaagaaagtaaaattggagcagca
gtatcatcatctgtaacatatcctcttacttctaagccagaagatgtatatgcagctaga
atgaatgataattttaaagtgtactatatgcttgatatgcatcattatggagaatatcca
gggtattatatgaagtatcttgaaaaaagaaatacagttcctcacatggaagatggggat
aaagagatacttaaaaaagctaaaatggattttatagctgtaaattattataggacaaat
tgtgcagaagctttacctgaagattcacaacatccatttggattaagagaaggaactgtt
gattttagtatgtatggactatttaaaatgtcaatgaatcctaacttagaggcttctgag
tatggagcagcaatagacccatcaggtcttagagttgccttaaatgaatattggcaaaga
tatcacttacctgttataataacagaaaatggtctaggagctaaagatatattagaagat
ggaaaaattcatgatgactatcgtatagactatttaagaagtcatataaatgcatgtaaa
ctagctattgaagatggtgtagagatgattggatattgtccatggtcatttacagacctt
ttaagttcttctcaaggttttaataagcgttatggacttgtttatataaatagaactgac
catgaagttttagatttaaaaagaatcaagaaagatagtttttactggtataaagaagtt
atagagaacaatggaatagtaaaataa

DBGET integrated database retrieval system