KEGG   Clostridium difficile R20291: CDR20291_0821Help
Entry
CDR20291_0821     CDS       T00998                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cdl  Clostridium difficile R20291
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cdl00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1000272..1001129
Genome map
AA seq 285 aa AA seqDB search
MNTFMSMDKNYEESNLIVFGVGFDGTTSNRPGARFASSSMRKEFYGLETYSPFLDLDLED
YNICDYGDLEISVGSTEQVLKEIYQETYKIVRDSKVPFMIGGEHLVTLPAFKAVHEKYND
IYVIHFDAHTDLREEYNNSKNSHATVIKRIWDIVGDNKIFQFGIRSGTKEEFKFATEEKH
TYMEIGGIDTFENIVNMLNGKNIYLTIDLDVLDASVFPGTGTPEPGGVNYREFQEIFKII
KNSNINIVGCDIVELSPDYDTTGVSTVIACKILRELCLIISDKIK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaacacttttatgagtatggacaaaaattatgaagaatctaatcttatagtatttggt
gttggatttgatggaactacttctaacagacctggggctagatttgcaagtagctctatg
agaaaagaattttacggtcttgagacatatagtccttttttagatttggacttagaggat
tataatatatgtgattatggagatttagaaattagtgttggaagtacagaacaagtctta
aaagaaatctatcaagagacatataagattgttagagattcaaaggtaccctttatgatt
ggaggagagcatttagttacattaccagcctttaaagcagtacatgaaaagtacaatgat
atatatgtaattcattttgatgcccatactgatttgagggaagaatataataatagtaaa
aattctcatgcaacagtaattaaaagaatatgggatattgtaggtgataataaaatattt
caatttggtataaggtctgggacaaaagaagaatttaaatttgctacagaagaaaaacac
acatacatggaaataggaggaatagatacgtttgaaaatatagttaatatgctaaatgga
aagaatatttatctaactatagatttagatgtattggatgcatctgtgtttccgggaaca
ggtacaccagaacctggtggtgtaaattatagagagtttcaagagatttttaagattata
aaaaactctaatataaatatagttggttgtgatattgtagagttaagccctgattacgat
acaacaggtgtatcgacagttatagcttgtaaaatcttaagagagttatgcttaataata
tctgataaaattaaatag

DBGET integrated database retrieval system