KEGG   Peptoclostridium difficile R20291: CDR20291_1299Help
Entry
CDR20291_1299     CDS       T00998                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cdl  Peptoclostridium difficile R20291
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CDR20291_1299 (folP)
Enzymes [BR:cdl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CDR20291_1299 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1539142..1539945
Genome map
AA seq 267 aa AA seqDB search
MSLIVFDYGKRTYIMGILNVTPDSFSDGGDFNNLDIAIQHAKDMVDQGADIIDLGGESTR
PGHSYVDSDEELRRVIPVIKKLKQELEIPISIDTYKADVAEEALKLGVTMVNDVWGLRKD
KNMASVIGKYDAEVCIMHNQDGTNYDKDIMESIKDFFKVSIEMAMSCGVKKEKIVLDPGV
GFGKDFEQNIEVLRRLNELKDLGYPILLGTSRKSVIGKVLPVEPKKRLEGTIATTVLGIR
DGVDIVRVHDVYENLMAARMTDAIYRK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgtcattaattgtgtttgattatggtaaaagaacttatataatgggaatattaaatgta
actccagatagtttttctgatggaggagattttaataacttggacatagcaatacaacat
gcaaaagatatggttgaccaaggtgcagatataatagacttaggaggagagtctacacgc
ccaggtcatagctatgtagactcagacgaagagctaagaagagtaatccctgtaataaaa
aaacttaaacaggaattggagataccaatatcaatagacacttataaggcagatgttgca
gaagaagcattaaaattaggtgtcactatggtaaatgatgtttggggtcttagaaaagat
aaaaatatggcttctgtaataggaaaatatgatgcagaagtgtgtataatgcataatcaa
gatgggacaaactatgacaaagatataatggagtcaataaaagacttttttaaggtaagt
atagaaatggcaatgagttgtggtgtaaaaaaagaaaaaatagtacttgacccaggcgta
ggatttggcaaggattttgaacaaaatattgaagtattgagaagattaaatgaattaaaa
gatttagggtatcctattttgcttgggacatccagaaaatcagtaataggaaaagtactt
ccagttgagcctaaaaaaagattagaaggtacaatagctactactgttcttggtataaga
gatggcgtagatatagttagagtacatgatgtttatgaaaatttaatggcagctagaatg
actgatgcaatatatagaaagtag

DBGET integrated database retrieval system