KEGG   Clostridium difficile R20291: CDR20291_1398Help
Entry
CDR20291_1398     CDS       T00998                                 

Gene name
hisC
Definition
histidinol-phosphate aminotransferase
Orthology
K00817  
histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
cdl  Clostridium difficile R20291
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cdl01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:cdl00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:cdl00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:cdl00360]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cdl00400]
Metabolism; Biosynthesis of other secondary metabolites; Novobiocin biosynthesis [PATH:cdl00401]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1653937..1654986
Genome map
AA seq 349 aa AA seqDB search
MREKESIRELRGYEPNHVNCKVKLDANEGSKRLFKYLIKEISDSDIDLNLYPEDSYSDLK
ESIIDYINISGVNKKNLLVGNGSSEIIDLIIHTFVDKDEVILSFSPSFSMYSIYSQINGS
KFIGVESDENLVINIDNVIEKVKENNPKIVIVCNPNNPTGTILKREEIIKLLDSTNSLVV
LDEAYMDFGEESMLSDVFKYDNLIVLRTLSKAFGLAGIRTGYMLSNSSLINSVEKVRPPY
NLNSLSDFIATRALRNKDVVKAYIKEVKEEREVLYEEMIGMGIKAYKSQANFILFYSEIE
NLSQKLIDRGVLIRKFGGKLENYYRVTIGDKEENSMFVGAIRDILKKEK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
ttgagagaaaaagaaagtataagagagttaaggggatatgaaccaaatcacgtaaactgt
aaagtaaaacttgatgcaaatgaaggaagtaagaggttgtttaaataccttattaaagaa
atttcagatagtgatatagatttaaatttatatcctgaagattcttatagtgatttgaaa
gaatctataatagattacataaatatttctggagtaaataagaaaaatcttctagtagga
aacggttcaagtgaaataattgatttaataatacatacttttgtagataaagatgaagta
atattgagtttctctccaagttttagtatgtattctatatatagtcagataaatgggtct
aaatttataggtgttgaaagtgatgaaaatttagttataaatatagataatgtgattgaa
aaagtaaaggagaataatcctaaaatagtaattgtatgtaatcctaataatccaactgga
acaatattaaagagggaagagataataaagcttttagattcaactaatagtctagtggtt
ttagatgaagcatatatggattttggagaagaaagcatgttaagtgatgtttttaagtat
gataatctaatagttcttagaactttatcaaaggcatttggattggctggaataagaaca
ggatatatgttatctaatagtagtttaataaattctgttgagaaagtaagacctccatat
aatttaaattcattatcagactttattgctacaagagcacttagaaataaagatgtggta
aaggcttatataaaggaagtaaaagaggaaagagaagttttatatgaagaaatgattggt
atgggaattaaagcatacaaatcacaagcaaattttatattattttattctgaaatcgaa
aatttatcacaaaaacttattgatagaggagttttaataagaaaatttggtggaaagtta
gaaaattattacagagttacaattggtgataaagaagaaaattctatgtttgttggagct
ataagagatattttgaaaaaggagaaatag

DBGET integrated database retrieval system