KEGG   Peptoclostridium difficile R20291: CDR20291_1398Help
Entry
CDR20291_1398     CDS       T00998                                 

Gene name
hisC
Definition
histidinol-phosphate aminotransferase
Orthology
K00817  
histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
cdl  Peptoclostridium difficile R20291
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cdl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CDR20291_1398 (hisC)
  Amino acid metabolism
   00340 Histidine metabolism
    CDR20291_1398 (hisC)
   00350 Tyrosine metabolism
    CDR20291_1398 (hisC)
   00360 Phenylalanine metabolism
    CDR20291_1398 (hisC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDR20291_1398 (hisC)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    CDR20291_1398 (hisC)
Enzymes [BR:cdl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     CDR20291_1398 (hisC)
Amino acid related enzymes [BR:cdl01007]
 Aminotransferase (transaminase)
  Class II
   CDR20291_1398 (hisC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1653937..1654986
Genome map
AA seq 349 aa AA seqDB search
MREKESIRELRGYEPNHVNCKVKLDANEGSKRLFKYLIKEISDSDIDLNLYPEDSYSDLK
ESIIDYINISGVNKKNLLVGNGSSEIIDLIIHTFVDKDEVILSFSPSFSMYSIYSQINGS
KFIGVESDENLVINIDNVIEKVKENNPKIVIVCNPNNPTGTILKREEIIKLLDSTNSLVV
LDEAYMDFGEESMLSDVFKYDNLIVLRTLSKAFGLAGIRTGYMLSNSSLINSVEKVRPPY
NLNSLSDFIATRALRNKDVVKAYIKEVKEEREVLYEEMIGMGIKAYKSQANFILFYSEIE
NLSQKLIDRGVLIRKFGGKLENYYRVTIGDKEENSMFVGAIRDILKKEK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
ttgagagaaaaagaaagtataagagagttaaggggatatgaaccaaatcacgtaaactgt
aaagtaaaacttgatgcaaatgaaggaagtaagaggttgtttaaataccttattaaagaa
atttcagatagtgatatagatttaaatttatatcctgaagattcttatagtgatttgaaa
gaatctataatagattacataaatatttctggagtaaataagaaaaatcttctagtagga
aacggttcaagtgaaataattgatttaataatacatacttttgtagataaagatgaagta
atattgagtttctctccaagttttagtatgtattctatatatagtcagataaatgggtct
aaatttataggtgttgaaagtgatgaaaatttagttataaatatagataatgtgattgaa
aaagtaaaggagaataatcctaaaatagtaattgtatgtaatcctaataatccaactgga
acaatattaaagagggaagagataataaagcttttagattcaactaatagtctagtggtt
ttagatgaagcatatatggattttggagaagaaagcatgttaagtgatgtttttaagtat
gataatctaatagttcttagaactttatcaaaggcatttggattggctggaataagaaca
ggatatatgttatctaatagtagtttaataaattctgttgagaaagtaagacctccatat
aatttaaattcattatcagactttattgctacaagagcacttagaaataaagatgtggta
aaggcttatataaaggaagtaaaagaggaaagagaagttttatatgaagaaatgattggt
atgggaattaaagcatacaaatcacaagcaaattttatattattttattctgaaatcgaa
aatttatcacaaaaacttattgatagaggagttttaataagaaaatttggtggaaagtta
gaaaattattacagagttacaattggtgataaagaagaaaattctatgtttgttggagct
ataagagatattttgaaaaaggagaaatag

DBGET integrated database retrieval system