KEGG   Clostridioides difficile R20291: CDR20291_1398Help
Entry
CDR20291_1398     CDS       T00998                                 

Gene name
hisC
Definition
(GenBank) putative histidinol-phosphate aminotransferase
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
cdl  Clostridioides difficile R20291
Pathway
cdl00340  Histidine metabolism
cdl00350  Tyrosine metabolism
cdl00360  Phenylalanine metabolism
cdl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cdl00401  Novobiocin biosynthesis
cdl01100  Metabolic pathways
cdl01110  Biosynthesis of secondary metabolites
cdl01130  Biosynthesis of antibiotics
cdl01230  Biosynthesis of amino acids
Module
cdl_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cdl00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    CDR20291_1398 (hisC)
   00350 Tyrosine metabolism
    CDR20291_1398 (hisC)
   00360 Phenylalanine metabolism
    CDR20291_1398 (hisC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDR20291_1398 (hisC)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    CDR20291_1398 (hisC)
Enzymes [BR:cdl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     CDR20291_1398 (hisC)
Amino acid related enzymes [BR:cdl01007]
 Aminotransferase (transaminase)
  Class II
   CDR20291_1398 (hisC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Alliinase_C Aminotran_5 Cys_Met_Meta_PP AlkA_N
Motif
Other DBs
NCBI-ProteinID: CBE03925
UniProt: C9YLE6
Position
1653937..1654986
Genome map
AA seq 349 aa AA seqDB search
MREKESIRELRGYEPNHVNCKVKLDANEGSKRLFKYLIKEISDSDIDLNLYPEDSYSDLK
ESIIDYINISGVNKKNLLVGNGSSEIIDLIIHTFVDKDEVILSFSPSFSMYSIYSQINGS
KFIGVESDENLVINIDNVIEKVKENNPKIVIVCNPNNPTGTILKREEIIKLLDSTNSLVV
LDEAYMDFGEESMLSDVFKYDNLIVLRTLSKAFGLAGIRTGYMLSNSSLINSVEKVRPPY
NLNSLSDFIATRALRNKDVVKAYIKEVKEEREVLYEEMIGMGIKAYKSQANFILFYSEIE
NLSQKLIDRGVLIRKFGGKLENYYRVTIGDKEENSMFVGAIRDILKKEK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
ttgagagaaaaagaaagtataagagagttaaggggatatgaaccaaatcacgtaaactgt
aaagtaaaacttgatgcaaatgaaggaagtaagaggttgtttaaataccttattaaagaa
atttcagatagtgatatagatttaaatttatatcctgaagattcttatagtgatttgaaa
gaatctataatagattacataaatatttctggagtaaataagaaaaatcttctagtagga
aacggttcaagtgaaataattgatttaataatacatacttttgtagataaagatgaagta
atattgagtttctctccaagttttagtatgtattctatatatagtcagataaatgggtct
aaatttataggtgttgaaagtgatgaaaatttagttataaatatagataatgtgattgaa
aaagtaaaggagaataatcctaaaatagtaattgtatgtaatcctaataatccaactgga
acaatattaaagagggaagagataataaagcttttagattcaactaatagtctagtggtt
ttagatgaagcatatatggattttggagaagaaagcatgttaagtgatgtttttaagtat
gataatctaatagttcttagaactttatcaaaggcatttggattggctggaataagaaca
ggatatatgttatctaatagtagtttaataaattctgttgagaaagtaagacctccatat
aatttaaattcattatcagactttattgctacaagagcacttagaaataaagatgtggta
aaggcttatataaaggaagtaaaagaggaaagagaagttttatatgaagaaatgattggt
atgggaattaaagcatacaaatcacaagcaaattttatattattttattctgaaatcgaa
aatttatcacaaaaacttattgatagaggagttttaataagaaaatttggtggaaagtta
gaaaattattacagagttacaattggtgataaagaagaaaattctatgtttgttggagct
ataagagatattttgaaaaaggagaaatag

DBGET integrated database retrieval system