KEGG   Clostridium difficile R20291: CDR20291_1479Help
Entry
CDR20291_1479     CDS       T00998                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
cdl  Clostridium difficile R20291
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cdl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CDR20291_1479 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    CDR20291_1479 (hisD)
Enzymes [BR:cdl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     CDR20291_1479 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1746172..1747437
Genome map
AA seq 421 aa AA seqDB search
MKSIKTSSMKEKVDEKILREQVSSIIEDIRNNKDVALKKYNEKFDRNTRDEFRITKEEIK
EAYKHVDDEFINNLKIAAKNIREFAKAQKLSFENPFEKEIYPGVILGQTNIPIESCLAYV
PGGQYPLFSTALMLIIPAKVAGVKRIVACSPTMKNTEKINPKTLVAMDIAGADEIYATGG
VQAIAAFTYGTEKINPVDIIVGPGNKFVTEAKRQCYGQVGIDFVAGPSEVLIIADETSNP
VYIAADLLAQCEHDLNARGILLTNSLEVAQKVEKNIESMLKDLPTKDIAYSSWENNGEII
LVDDMEEAIKISNFYAPEHLEVAVNEYNDICDRLTNYGSLFIGNLSAEVFGDYVSGTNHT
LPTLKASRYTGGVWVGTFIKTCTKQIFNEKAIQSLAPVAEKLAKEEGLYAHAKAAEVRFK
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtattaaaacatcaagtatgaaagaaaaggtagatgaaaagatattaagagag
caagtaagttctataatagaagatataagaaataataaggatgttgcacttaaaaaatat
aatgagaagtttgatagaaatacaagagatgaatttagaattactaaggaagaaataaag
gaagcttataagcatgtagatgacgaatttataaataacttaaagattgctgccaaaaat
ataagagaatttgctaaagctcaaaaactaagttttgaaaacccttttgaaaaagaaatt
tatccaggtgtaatcttaggtcaaactaatattccaatagagtcatgtcttgcatatgtt
ccaggaggtcagtatccattgttttcaacagctcttatgcttataatacctgcaaaagta
gcaggagtaaaaagaatagtggcatgttcaccaactatgaaaaatactgaaaagataaat
cctaaaacattggtagctatggatatagcaggtgctgatgaaatatatgcaactggagga
gttcaagctatagcagcatttacatatggaacagaaaagattaatccagttgacataatt
gtaggaccaggaaataagtttgtaactgaagctaaaagacaatgttatggacaagtagga
attgattttgtcgctgggccaagtgaagttcttataatagcggatgaaacttcaaatcca
gtttatattgcagctgatttattagcacaatgtgagcatgatttaaatgcaagaggaata
ttattgacaaatagcttggaagtagcacaaaaagttgaaaaaaatatagaaagtatgcta
aaagatttgccaacaaaggacatagcatatagttcatgggaaaataatggagagataata
ttggttgatgatatggaagaagccattaaaataagtaatttttatgcaccagaacattta
gaagttgcagtaaatgagtataatgatatttgtgatagattaactaactatggttcttta
tttattggaaatctttctgctgaggtgtttggtgactatgtttcaggtaccaatcataca
ttaccaacacttaaagcatcaagatatactggtggtgtttgggttggaacttttatcaaa
acttgtacaaagcagatatttaatgaaaaagctatacaatcattagcacctgtagctgaa
aagctggcaaaagaagagggattatatgcacatgcaaaggctgctgaggttaggtttaaa
aagtag

DBGET integrated database retrieval system