KEGG   Peptoclostridium difficile R20291: CDR20291_2025Help
Entry
CDR20291_2025     CDS       T00998                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cdl  Peptoclostridium difficile R20291
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cdl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CDR20291_2025 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDR20291_2025 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CDR20291_2025 (thrC)
Enzymes [BR:cdl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CDR20291_2025 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2372439..2373920
Genome map
AA seq 493 aa AA seqDB search
MYYSSTRGTEEKVTASQAIIKGISSDGGLYVPSEFPNVKNELINLVNLTYSQIAFFVLSK
FLCDFTEDEIKNCIENAYDEKFDCSSIAPLNKVNDTYFLELYHGPTLAFKDMALTIMPHL
LKTSIKKDNLEKDVVILTATSGDTGKAALEGFKDIDKIKIIVFFPEDGVSPVQKLQMKTQ
TGKNTYVVGIKGNFDDAQSGVKKIFSDKKFNQKLLDNNYILSSANSINIGRLLPQVAYYF
YSYMKLVSNSEINLNDKINFVVPTGNFGNILAGYYAKQMGLPINKLICASNDNNVLYDFF
KTGVYDKNRTLKLTTSPSMDILISSNLERLLFEISNRNTDIVNKLLSDLSDKGVYKISDD
MEKNLASFYGEYSNEEEVKSTINNVFKNYNYLIDTHTAVAYNCYEKYKKETSDNTKTVIV
STASPFKFSEDVLKSIDCDFKDLDDFAIIDRLSSISKIDIPKPIKNLKNAEILHKDIYEK
DELKLAIKKFLKV
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtattattcaagtacgagaggcaccgaagaaaaagtaactgcatcacaagcaataata
aaaggaatatcaagtgatggtggtctttatgttccaagtgaatttcccaatgtaaaaaat
gaacttataaatttagtaaatttaacgtattctcagatagcattttttgtacttagtaaa
tttttatgtgattttactgaagatgaaattaaaaattgtatagaaaatgcatatgatgaa
aagtttgattgtagtagtatagctccattaaataaagtaaatgatacttatttcttagaa
ctatatcacggtccaactttagcatttaaagatatggcacttactataatgcctcatctt
cttaaaacatctataaagaaagataatttagagaaagatgttgtgattcttactgctaca
tctggagatacaggcaaagctgcacttgagggatttaaagatatagataaaataaagata
attgtattcttcccagaagatggtgtaagcccagtacaaaaacttcaaatgaaaactcaa
actggaaaaaatacatatgtagttggtataaaaggaaattttgatgatgcacaatcaggt
gtaaagaagattttttctgataaaaaatttaatcaaaaactattggataataattatata
ttatcttctgcaaattcaattaatataggaagacttcttccacaagttgcatactatttt
tattcatatatgaaattagttagcaatagtgagataaatttaaatgataaaataaatttt
gttgtcccaactggtaattttggtaatattctagctggatattatgccaaacaaatgggt
cttccaataaacaaattgatatgtgcatcaaatgataataatgttctttatgatttcttt
aaaactggtgtatatgataaaaatagaacattgaaattaactacttctccttctatggat
atattaatttcaagtaatttagaacgattactgtttgaaatatcaaatagaaatactgat
attgtaaataagctgttatcagaccttagtgataaaggagtctacaaaataagtgatgat
atggaaaaaaatttagcctcattctatggagaatattcaaatgaagaagaagttaaaagc
acgataaacaatgtgtttaaaaattataattatttgatagatactcatactgctgttgca
tacaattgttatgaaaaatataaaaaagaaacttctgataacacaaaaactgttattgta
agtactgcaagtccattcaagttttctgaagatgttctaaagtctatagattgtgatttt
aaagaccttgatgactttgctataattgatagattatcaagtatttctaaaatagatatt
ccaaaacctattaaaaatcttaaaaatgcagaaatactacataaagatatttatgaaaaa
gatgaattaaaactagctataaaaaaattcttaaaggtatag

DBGET integrated database retrieval system