KEGG   Clostridium difficile R20291: CDR20291_2037Help
Entry
CDR20291_2037     CDS       T00998                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cdl  Clostridium difficile R20291
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cdl00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2387621..2388775)
Genome map
AA seq 384 aa AA seqDB search
MKKISILGSTGSIGKQTLDVVREHRDKFEIVAISANSNIELLLEQIVEFKPKYVTVFEEN
KALKLKEMLPKNIEIEVLAGMEGLKIISSLDEVDVLLTAVVGMIGLVPTLCAIKKGIDIA
LANKETLVTAGELVMKEAEKYNVNILPVDSEHSAIFQCLNGENKKNIEKIILTASGGPFR
GKKKGELVNITKNEALKHPNWSMGRKISIDSSTLMNKGLEVIEARWLFRVEQENIDVVVH
PQSIIHSMVQYADSSIIAQLGCPDMRLPIQYALTYPDRMESSFERMNFSKFSTLTFEEPD
LETFPCLKLAYECLKMGGTYSSVLNSANEVLVSEFLEDKIGFYDIPYYIEKTLEVHSSIS
EPTLEEILETDRWSRAYVANLIKK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatatcaattttaggttctacaggctctataggtaaacaaactttggatgtg
gttagagaacatagagataagtttgagatagttgcaatatcagctaacagtaatattgaa
ttattgctagaacaaatagtagagtttaaacctaaatatgtaacagtttttgaggaaaat
aaggcattgaaattaaaagaaatgttgcctaaaaatatagaaatagaagttttagcagga
atggaaggattaaaaataatatcatcacttgatgaagtggatgtccttttaactgctgta
gtaggtatgataggattagtcccaactctttgtgctataaagaagggaatagacatagca
ttagcgaataaagaaacgttggtaactgctggtgaacttgtaatgaaagaagcagaaaaa
tacaatgtaaatattcttcctgttgatagtgaacatagtgctatatttcaatgtctaaat
ggagaaaataaaaaaaatatagaaaagataatacttacagcatctggtggtccatttaga
ggaaagaaaaagggagaacttgtaaatataactaaaaatgaagctttgaagcatccaaat
tggagtatgggaagaaaaataagtattgattcttcaacgcttatgaataaaggacttgaa
gtgatagaagctagatggttgtttagggtagaacaagaaaatatagatgtagtagttcac
ccacaaagcataattcattcaatggtgcagtatgcagatagctcaataattgctcaatta
gggtgtccagatatgagactaccaatacagtatgctcttacatatccagatagaatggaa
agtagctttgaaagaatgaatttttcaaaatttagtactttaacttttgaagaaccagat
ttagaaacttttccatgtttaaaattggcctatgagtgtttaaaaatgggaggaacttat
tcttctgttttaaattcagcaaatgaagttttagtaagtgaatttttagaggataaaatt
ggtttttatgacataccatattacatagagaagactttagaagttcatagtagcataagc
gaaccaacattagaagaaatcttagaaacagatagatggagtagagcttatgttgcaaat
ctgataaaaaaatag

DBGET integrated database retrieval system