KEGG   Clostridioides difficile R20291: CDR20291_2037Help
Entry
CDR20291_2037     CDS       T00998                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-d-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cdl  Clostridioides difficile R20291
Pathway
cdl00900  Terpenoid backbone biosynthesis
cdl01100  Metabolic pathways
cdl01110  Biosynthesis of secondary metabolites
cdl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cdl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CDR20291_2037 (dxr)
Enzymes [BR:cdl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CDR20291_2037 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh Sacchrp_dh_NADP DapB_N
Motif
Other DBs
NCBI-ProteinID: CBE05048
UniProt: C9YN78
Position
complement(2387621..2388775)
Genome map
AA seq 384 aa AA seqDB search
MKKISILGSTGSIGKQTLDVVREHRDKFEIVAISANSNIELLLEQIVEFKPKYVTVFEEN
KALKLKEMLPKNIEIEVLAGMEGLKIISSLDEVDVLLTAVVGMIGLVPTLCAIKKGIDIA
LANKETLVTAGELVMKEAEKYNVNILPVDSEHSAIFQCLNGENKKNIEKIILTASGGPFR
GKKKGELVNITKNEALKHPNWSMGRKISIDSSTLMNKGLEVIEARWLFRVEQENIDVVVH
PQSIIHSMVQYADSSIIAQLGCPDMRLPIQYALTYPDRMESSFERMNFSKFSTLTFEEPD
LETFPCLKLAYECLKMGGTYSSVLNSANEVLVSEFLEDKIGFYDIPYYIEKTLEVHSSIS
EPTLEEILETDRWSRAYVANLIKK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatatcaattttaggttctacaggctctataggtaaacaaactttggatgtg
gttagagaacatagagataagtttgagatagttgcaatatcagctaacagtaatattgaa
ttattgctagaacaaatagtagagtttaaacctaaatatgtaacagtttttgaggaaaat
aaggcattgaaattaaaagaaatgttgcctaaaaatatagaaatagaagttttagcagga
atggaaggattaaaaataatatcatcacttgatgaagtggatgtccttttaactgctgta
gtaggtatgataggattagtcccaactctttgtgctataaagaagggaatagacatagca
ttagcgaataaagaaacgttggtaactgctggtgaacttgtaatgaaagaagcagaaaaa
tacaatgtaaatattcttcctgttgatagtgaacatagtgctatatttcaatgtctaaat
ggagaaaataaaaaaaatatagaaaagataatacttacagcatctggtggtccatttaga
ggaaagaaaaagggagaacttgtaaatataactaaaaatgaagctttgaagcatccaaat
tggagtatgggaagaaaaataagtattgattcttcaacgcttatgaataaaggacttgaa
gtgatagaagctagatggttgtttagggtagaacaagaaaatatagatgtagtagttcac
ccacaaagcataattcattcaatggtgcagtatgcagatagctcaataattgctcaatta
gggtgtccagatatgagactaccaatacagtatgctcttacatatccagatagaatggaa
agtagctttgaaagaatgaatttttcaaaatttagtactttaacttttgaagaaccagat
ttagaaacttttccatgtttaaaattggcctatgagtgtttaaaaatgggaggaacttat
tcttctgttttaaattcagcaaatgaagttttagtaagtgaatttttagaggataaaatt
ggtttttatgacataccatattacatagagaagactttagaagttcatagtagcataagc
gaaccaacattagaagaaatcttagaaacagatagatggagtagagcttatgttgcaaat
ctgataaaaaaatag

DBGET integrated database retrieval system