KEGG   Peptoclostridium difficile R20291: CDR20291_2175Help
Entry
CDR20291_2175     CDS       T00998                                 

Definition
sugar phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cdl  Peptoclostridium difficile R20291
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cdl00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CDR20291_2175
Enzymes [BR:cdl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     CDR20291_2175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2558761..2559408)
Genome map
AA seq 215 aa AA seqDB search
MLDSLKGKVVEIAIKAEHYGLCKEKTGNFSIRDKDTGYILITPSGIGREELNVEHICVLD
LNGNVIEVEKGIKPSSEVLMHIEIYKIRENINAISHTHSLYATAFSVAKKPIIPIVYESV
NYGGYVDIAPYERPGTLKLAKSVSKLLIDTDACLLERHGLTTVGNDLDEALLKSRYVEEV
AEIYYRSLVLNQFKELEVVDVDEFESWKYPEEIKF
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgctagactctttaaaaggtaaagttgtggaaatagcaattaaagcagagcattatggt
ttatgtaaagaaaagactggtaattttagtattagagataaggatactggatatatactt
ataaccccatcaggtataggaagagaagaattaaacgttgaacatatttgtgtattggat
ttgaatggaaatgtaatagaagttgagaaaggtattaagccaagtagtgaggtattgatg
catattgaaatatataaaataagggaaaatataaatgctatatcacatactcattcttta
tatgcaacagcattttcagtagcaaagaaaccaattataccaattgtatatgaatcagtt
aattatggcggttatgtagatattgctccatacgaaagaccaggaactttaaaattagct
aagagcgtttcaaaattactgatagatacagatgcatgcttattagaaagacatgggttg
acaactgtaggtaatgatttagacgaagcattattaaaatcaagatatgttgaagaggta
gcagaaatatactataggtctttagtattaaatcaatttaaagaacttgaagtagtagat
gttgatgagtttgaatcttggaaatacccagaagaaataaagttttaa

DBGET integrated database retrieval system