KEGG   Clostridium difficile R20291: CDR20291_2231Help
Entry
CDR20291_2231     CDS       T00998                                 

Gene name
sucD
Definition
succinate-semialdehyde dehydrogenase [NAD(P)+]
Orthology
K18119  
succinate-semialdehyde dehydrogenase [EC:1.2.1.76]
Organism
cdl  Clostridium difficile R20291
Pathway
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cdl00650]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2620206..2621597)
Genome map
AA seq 463 aa AA seqDB search
MEKAVENFEDLSKEYINGYIERARKAQREFECYTQEQVDKIVKIVGKVVYYNAEYLAKLA
VEETGMGVYEDKVAKNKSKAKVIYNNLKDKKSVGIIDIDRETGITKVAKPVGVVAAITPC
TNPIVTPMSNAMFALKGRNAIIITPHHKAIGCSTKTVEMINEELEKIGAPENLIQILDQQ
SRENTRNLISSADVVIATGGMGMVKAAYSSGKPALGVGAGNVQCIIDRDVDIKEAVPKII
AGRIFDNGIICSGEQSVIVAEEMFDKIMDEFKNNKGFIVRDKVQKEAFRNAMFVNKSMNK
DAVGQSVHTIAKIAGVEIPEDTKIIVIEADGPGEEDIIAKEKMCPVISAYKYKSFEEGVA
IAKANLNVEGKGHSVSIHSNTVKNIEYAGENIEVSRFVINQCCATSAGGSFFNGLAPTNT
LGCGSWGNNSISENLDYKHLINISRIAYYMPENEVPTDEELWG
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagcagtggaaaactttgaagatttaagtaaggaatacattaatggttatatt
gagagagcaagaaaagctcaaagagagtttgaatgttatactcaagaacaagtagataaa
atagtaaaaatagttggaaaagtagtgtattataatgctgaatatttagctaaacttgct
gtagaagagactggaatgggagtatatgaagataaggtagctaaaaataaaagcaaagca
aaagttatatataacaatttaaaagataaaaaatcagttggtataattgatatagataga
gaaactggaataacaaaggtagctaaaccagttggagtagtagcggcaataactccttgt
acaaatccaatcgttacacctatgagcaatgcaatgtttgcacttaagggaagaaatgca
attattatcacacctcatcataaagcaattggatgtagtacaaaaactgtagagatgatt
aatgaagaattagaaaaaataggagctccagaaaatttaatacaaatacttgaccaacaa
tcaagagaaaatacaagaaatttaatttcatcagcagatgtagtaattgccactggagga
atgggaatggtaaaagctgcgtactcaagtggaaaaccagcacttggtgtaggggcagga
aatgttcaatgtatcatagatagagatgtagacattaaagaagcagtacctaaaatcata
gcaggaagaatttttgataatggtatcatttgttcaggtgaacagtcagtaatagtagca
gaagaaatgtttgataaaataatggatgaatttaaaaataacaaaggttttatagttaga
gataaagtacaaaaagaagctttcagaaatgctatgtttgtaaataaatctatgaataaa
gatgcagtaggtcaatcagttcatacaattgcaaaaattgcaggtgttgagataccagaa
gatacaaaaataatagtaatagaagctgatggaccaggagaagaggatattattgcaaaa
gaaaaaatgtgtccagttatatctgcatacaagtataaaagttttgaagaaggtgtagct
attgcaaaagcaaatttaaatgtagaaggaaaaggacatagtgtatctatacattcaaat
acagttaaaaatatagaatatgcaggagaaaatatagaagtatcaagatttgttattaat
caatgttgtgctactagtgctggaggaagtttctttaatggtcttgcacctactaatact
ctaggttgtggttcttggggaaataacagcatctctgaaaatcttgattataagcatcta
attaatatttctagaattgcttattatatgccagaaaatgaagtccctacagatgaagaa
ctttggggataa

DBGET integrated database retrieval system