KEGG   Peptoclostridium difficile R20291: CDR20291_2231Help
Entry
CDR20291_2231     CDS       T00998                                 

Gene name
sucD
Definition
succinate-semialdehyde dehydrogenase [NAD(P)+]
Orthology
K18119  
succinate-semialdehyde dehydrogenase [EC:1.2.1.76]
Organism
cdl  Peptoclostridium difficile R20291
Pathway
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cdl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CDR20291_2231 (sucD)
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CDR20291_2231 (sucD)
Enzymes [BR:cdl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.76  succinate-semialdehyde dehydrogenase (acylating)
     CDR20291_2231 (sucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2620206..2621597)
Genome map
AA seq 463 aa AA seqDB search
MEKAVENFEDLSKEYINGYIERARKAQREFECYTQEQVDKIVKIVGKVVYYNAEYLAKLA
VEETGMGVYEDKVAKNKSKAKVIYNNLKDKKSVGIIDIDRETGITKVAKPVGVVAAITPC
TNPIVTPMSNAMFALKGRNAIIITPHHKAIGCSTKTVEMINEELEKIGAPENLIQILDQQ
SRENTRNLISSADVVIATGGMGMVKAAYSSGKPALGVGAGNVQCIIDRDVDIKEAVPKII
AGRIFDNGIICSGEQSVIVAEEMFDKIMDEFKNNKGFIVRDKVQKEAFRNAMFVNKSMNK
DAVGQSVHTIAKIAGVEIPEDTKIIVIEADGPGEEDIIAKEKMCPVISAYKYKSFEEGVA
IAKANLNVEGKGHSVSIHSNTVKNIEYAGENIEVSRFVINQCCATSAGGSFFNGLAPTNT
LGCGSWGNNSISENLDYKHLINISRIAYYMPENEVPTDEELWG
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagcagtggaaaactttgaagatttaagtaaggaatacattaatggttatatt
gagagagcaagaaaagctcaaagagagtttgaatgttatactcaagaacaagtagataaa
atagtaaaaatagttggaaaagtagtgtattataatgctgaatatttagctaaacttgct
gtagaagagactggaatgggagtatatgaagataaggtagctaaaaataaaagcaaagca
aaagttatatataacaatttaaaagataaaaaatcagttggtataattgatatagataga
gaaactggaataacaaaggtagctaaaccagttggagtagtagcggcaataactccttgt
acaaatccaatcgttacacctatgagcaatgcaatgtttgcacttaagggaagaaatgca
attattatcacacctcatcataaagcaattggatgtagtacaaaaactgtagagatgatt
aatgaagaattagaaaaaataggagctccagaaaatttaatacaaatacttgaccaacaa
tcaagagaaaatacaagaaatttaatttcatcagcagatgtagtaattgccactggagga
atgggaatggtaaaagctgcgtactcaagtggaaaaccagcacttggtgtaggggcagga
aatgttcaatgtatcatagatagagatgtagacattaaagaagcagtacctaaaatcata
gcaggaagaatttttgataatggtatcatttgttcaggtgaacagtcagtaatagtagca
gaagaaatgtttgataaaataatggatgaatttaaaaataacaaaggttttatagttaga
gataaagtacaaaaagaagctttcagaaatgctatgtttgtaaataaatctatgaataaa
gatgcagtaggtcaatcagttcatacaattgcaaaaattgcaggtgttgagataccagaa
gatacaaaaataatagtaatagaagctgatggaccaggagaagaggatattattgcaaaa
gaaaaaatgtgtccagttatatctgcatacaagtataaaagttttgaagaaggtgtagct
attgcaaaagcaaatttaaatgtagaaggaaaaggacatagtgtatctatacattcaaat
acagttaaaaatatagaatatgcaggagaaaatatagaagtatcaagatttgttattaat
caatgttgtgctactagtgctggaggaagtttctttaatggtcttgcacctactaatact
ctaggttgtggttcttggggaaataacagcatctctgaaaatcttgattataagcatcta
attaatatttctagaattgcttattatatgccagaaaatgaagtccctacagatgaagaa
ctttggggataa

DBGET integrated database retrieval system