KEGG   Clostridioides difficile R20291: CDR20291_2352Help
Entry
CDR20291_2352     CDS       T00998                                 

Gene name
glcK
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cdl  Clostridioides difficile R20291
Pathway
cdl00010  Glycolysis / Gluconeogenesis
cdl00052  Galactose metabolism
cdl00500  Starch and sucrose metabolism
cdl00520  Amino sugar and nucleotide sugar metabolism
cdl00521  Streptomycin biosynthesis
cdl01100  Metabolic pathways
cdl01110  Biosynthesis of secondary metabolites
cdl01120  Microbial metabolism in diverse environments
cdl01130  Biosynthesis of antibiotics
cdl01200  Carbon metabolism
Module
cdl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cdl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cdl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDR20291_2352 (glcK)
   00052 Galactose metabolism
    CDR20291_2352 (glcK)
   00500 Starch and sucrose metabolism
    CDR20291_2352 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    CDR20291_2352 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CDR20291_2352 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CDR20291_2352 (glcK)
Enzymes [BR:cdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CDR20291_2352 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase FGGY_N DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: CBE05607
UniProt: C9YP39
Position
complement(2751941..2752876)
Genome map
AA seq 311 aa AA seqDB search
MYYIGVDIGGTGIQAGVVDNYGKIIFRSECKTVIEKGFEGILNDIKIMIYKLLEDNKLTM
SDIKSIGFGVPGFINKEGLVTCVNLKWNKKAFNKELKRRFPDAEIHGENDATVAALGEAK
FGSMKGANVGVLYTLGTGVGGGIVINQKVFSGAHGLGSEIGHQIIGENYFNCNCGNNGCV
ETFCSATAIIKYSQKLIEEGEKSRILDLAEGNLENVNAKMVFDAYRENDLVAIKVINRFK
DYLAKTFANTINSLDPEIISIGGGISKSSDIILDGIEDLVRKFVLYKTEDIATITCATLG
SDAGIIGAAFL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtattatataggtgtagacataggaggaacaggtatacaagcaggagtagttgataac
tatgggaagataatttttaggtcagagtgtaaaacagtaattgaaaaaggctttgaagga
atacttaatgacataaaaataatgatttataagttgttggaagataataaacttactatg
agtgacataaaatctattggatttggtgttccaggttttataaataaagaaggattagta
acttgtgtaaatttaaaatggaataaaaaagcttttaataaagagttaaaaagaagattt
ccagatgctgaaattcatggagaaaatgatgcaacagtagcagcacttggagaagcaaag
tttggaagtatgaaaggtgctaatgttggagtattatatactttaggaactggtgtaggt
ggaggaatagtaattaatcaaaaagtcttttctggagcacatggattgggttcagaaata
ggtcatcaaattataggagaaaactattttaattgtaattgtggaaataatggttgtgta
gaaactttttgttcagcaactgcaattataaagtattctcaaaaactgatagaagaagga
gaaaagagtaggattttagatttggcagagggaaatttagaaaatgtaaatgcaaagatg
gtgtttgatgcatatagagaaaatgatttagtggcaattaaagtaataaatagatttaaa
gattatttagcaaaaacttttgcaaacacaataaattctttagacccagaaattatatct
ataggaggaggcatttctaaatctagcgatataatacttgatggaatagaagatttggta
agaaaatttgtattatacaaaacagaagatatagctacaattacatgtgcaactttaggt
tcagacgcaggaattataggagcagcttttttataa

DBGET integrated database retrieval system