KEGG   Clostridium difficile R20291: CDR20291_2475Help
Entry
CDR20291_2475     CDS       T00998                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cdl  Clostridium difficile R20291
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cdl00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2900899..2901516)
Genome map
AA seq 205 aa AA seqDB search
MFVKKGLLLVVSGPSGAGKGTICKELLKENDTIKLSVSATTRKPRTGEVDGVNYFFISKE
KFEEMIEKGEFLEYAQIYDNFYGTPKAAIMECLEKGQDVLLEIEMQGAKQIKEVCPEGVF
IFVLPPSLEELKNRIVGRGTETEAEIEKRFSCAYEEIKMIKDYDYFIFNEDVKTSAKEIE
GIISSEKNKVSRYKNIIIEKFKEEL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtgaaaaaaggattattgctagttgtatcaggaccatcaggtgcaggaaaaggt
actatttgcaaagaactacttaaagaaaatgatacaataaaactttctgtatcagctact
acaagaaaacccagaactggagaagttgatggagtaaattatttcttcataagtaaggaa
aagtttgaagagatgatagaaaaaggtgagtttttggagtatgctcaaatttatgataat
ttttatggaactccaaaagcggcaataatggaatgtttagaaaaaggacaagatgtatta
ctggagattgaaatgcaaggagcaaaacaaataaaagaagtttgcccagagggagtattt
atatttgtactaccaccatcacttgaagaattaaaaaatagaattgttggaagaggtaca
gaaacagaagctgaaatagagaagagatttagctgtgcatatgaagaaattaaaatgatt
aaggattatgattattttatatttaatgaagatgtaaaaacatctgctaaagaaatagaa
ggtataatatcatctgaaaagaataaagttagcagatataaaaatattataatagagaaa
tttaaggaggaattataa

DBGET integrated database retrieval system