KEGG   Peptoclostridium difficile R20291: CDR20291_2603Help
Entry
CDR20291_2603     CDS       T00998                                 

Gene name
gtaB
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cdl  Peptoclostridium difficile R20291
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cdl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CDR20291_2603 (gtaB)
   00052 Galactose metabolism
    CDR20291_2603 (gtaB)
   00500 Starch and sucrose metabolism
    CDR20291_2603 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    CDR20291_2603 (gtaB)
Enzymes [BR:cdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CDR20291_2603 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3055548..3056492)
Genome map
AA seq 314 aa AA seqDB search
MKKKYKYGILIWYNRKFTKKGEKMQMTVKKAIIPAAGLGTRFLPATKSQPKEMLPIVDKP
TLQYIIEEAIESGIEEILIITGRNKKSIEDHFDKSVELELELEQKGKTEMLEMVRDISNM
VNIHYIRQKEPKGLGHAIYCAKSFIGDEPFAVLLGDDIVDSDVPCLKQLIDTYNEYKTTV
LGVQKIAKEDTNKYGILDVKHIEDRVYKVKDMVEKPAIEEAPSDIAILGRYIITPAIFSI
LEKQTPGKGGEIQLTDALQTLGKQEAIYAYNFEGRRYDVGDKIGFLEATIDFALKRENLK
DDLMDYMRKKVSEK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaaaagtataaatatggtatattaatttggtacaatagaaaatttacgaagaag
ggtgaaaaaatgcagatgacagttaaaaaagcaataataccagcagcagggctaggaacc
agatttttaccagcaacaaaatcacagcccaaagaaatgcttcctatagtagataaacca
actttacagtatataatagaagaagctatagaatcgggaattgaagaaattcttataata
acaggtagaaataaaaaatctatagaagatcattttgataaatcagttgaattagagtta
gaactagagcaaaaaggtaagacagagatgttagaaatggtaagagacatatcaaatatg
gtaaatattcattatataagacaaaaagagccaaaaggtcttggacatgcaatttactgt
gcaaaaagttttataggtgatgaaccttttgccgtattattaggtgatgatatagtagat
tcagatgttccgtgcttaaaacaattaatagatacttataatgagtataaaacaactgta
ttaggtgttcaaaagatagctaaagaagatactaataaatatggtatattggatgtaaaa
catatcgaagatagagtatataaagttaaagatatggttgaaaaacctgcaattgaagaa
gctccatctgatatagctatacttggaagatatataataactcctgcaatatttagtata
ttagagaaacagacacctggtaaaggtggagagatacaactgacagatgcacttcaaact
cttggaaaacaagaggctatttatgcttataactttgaaggtagaagatatgatgtggga
gataagattggttttttagaggcaacaatagactttgctctaaagagagaaaatttaaaa
gatgatttaatggactatatgagaaaaaaagtaagtgaaaaataa

DBGET integrated database retrieval system