KEGG   Peptoclostridium difficile R20291: CDR20291_2615Help
Entry
CDR20291_2615     CDS       T00998                                 

Gene name
glyA
Definition
serine hydroxymethyltransferase
Orthology
K00600  
glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
cdl  Peptoclostridium difficile R20291
Pathway
Glycine, serine and threonine metabolism
Cyanoamino acid metabolism
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:cdl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CDR20291_2615 (glyA)
   01230 Biosynthesis of amino acids
    CDR20291_2615 (glyA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CDR20291_2615 (glyA)
  Energy metabolism
   00680 Methane metabolism
    CDR20291_2615 (glyA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDR20291_2615 (glyA)
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    CDR20291_2615 (glyA)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CDR20291_2615 (glyA)
Enzymes [BR:cdl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     CDR20291_2615 (glyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3076510..3077754)
Genome map
AA seq 414 aa AA seqDB search
MFENLKKADPEIYESMKRELKRQQRNIELIASENIVSVPVMETMGSHLTNKYAEGYSGKR
YYGGCEYIDEVETLAIDRIKKIFGAEHANVQPHSGANANIGVYFAMLKPGDVVMGMNLSQ
GGHLTHGAPVNISGQYYKFYEYGIDKDSGLIDFDEVRKIAHEVKPKMIVAGASAYPREID
FKKFREIADEVGALLMVDMAHIAGLVAAGIHQNPCEVADFVTTTTHKTLRGPRGGVILCK
EKYAKDIDKAIFPGIQGGPLEHIIASKAVCFKEALSDEFKEYQVQVAKNAKALAEELIKR
DFKLISGGTDNHLILLDLINKNITGKAAEKRLDDAYITANKNTIPFDPNGALVTSGIRLG
TPAVTTRGMKEEDMAIIAEAIDLCLTYDEESKARTLVVGLTEKYPLYEEYNIMD
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagaacttgaaaaaagcggatcctgagatttatgaaagtatgaaaagagagtta
aaaagacaacaaagaaatattgaattaatagcatctgaaaacatagtatcagttccagta
atggaaactatgggaagtcatcttacaaataagtatgcagaaggttactcaggcaaaaga
tattatggtggatgtgaatacatagatgaagttgaaactcttgcaatagatagaatcaaa
aaaatatttggagcagaacatgctaatgttcaacctcactctggagcaaatgcaaatatt
ggtgtatattttgctatgttaaaaccaggtgatgttgttatgggaatgaatttatctcaa
ggtggacatttaactcatggtgctccagttaatatttctggtcaatattataaattttat
gaatatggtatagataaagacagtggacttatagattttgatgaagttagaaagatagca
catgaagtaaaacctaaaatgatagttgcaggagcaagtgcatatcctagagaaatagat
tttaaaaagtttagagagatagctgatgaggttggagcattgcttatggtagatatggct
catatagcaggtcttgtggctgctggtattcaccaaaatccatgtgaagtggctgatttt
gttacaacaacaactcacaaaactttaagaggacctcgtgggggtgttattctttgtaaa
gaaaaatatgctaaagacatagacaaagcaatattccctggtattcaaggtggacctctt
gaacatataattgcttctaaggcagtttgctttaaagaagctttaagtgatgagtttaaa
gaatatcaggtacaagttgctaaaaatgcaaaagccttagctgaagaacttattaaaaga
gattttaaattgatttctggaggtacagataatcatttaatactattagatttgattaat
aaaaatataactggtaaagcagcagaaaagagattggatgatgcttatataacagctaat
aaaaatacaattccatttgatccaaatggtgctcttgttacaagtggaataagacttggt
actccagctgtaactactagaggtatgaaagaagaagatatggcaataatcgctgaggct
atagacctatgtttaacttatgatgaagaatctaaggctagaacattggttgttggttta
actgaaaaatatcctttatatgaagaatataatattatggattaa

DBGET integrated database retrieval system