KEGG   Clostridium difficile R20291: CDR20291_2615Help
Entry
CDR20291_2615     CDS       T00998                                 

Gene name
glyA
Definition
serine hydroxymethyltransferase
Orthology
K00600  
glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
cdl  Clostridium difficile R20291
Pathway
Glycine, serine and threonine metabolism
Cyanoamino acid metabolism
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
C1-unit interconversion, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:cdl01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cdl01230]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:cdl00630]
Metabolism; Energy metabolism; Methane metabolism [PATH:cdl00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cdl00260]
Metabolism; Metabolism of other amino acids; Cyanoamino acid metabolism [PATH:cdl00460]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cdl00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3076510..3077754)
Genome map
AA seq 414 aa AA seqDB search
MFENLKKADPEIYESMKRELKRQQRNIELIASENIVSVPVMETMGSHLTNKYAEGYSGKR
YYGGCEYIDEVETLAIDRIKKIFGAEHANVQPHSGANANIGVYFAMLKPGDVVMGMNLSQ
GGHLTHGAPVNISGQYYKFYEYGIDKDSGLIDFDEVRKIAHEVKPKMIVAGASAYPREID
FKKFREIADEVGALLMVDMAHIAGLVAAGIHQNPCEVADFVTTTTHKTLRGPRGGVILCK
EKYAKDIDKAIFPGIQGGPLEHIIASKAVCFKEALSDEFKEYQVQVAKNAKALAEELIKR
DFKLISGGTDNHLILLDLINKNITGKAAEKRLDDAYITANKNTIPFDPNGALVTSGIRLG
TPAVTTRGMKEEDMAIIAEAIDLCLTYDEESKARTLVVGLTEKYPLYEEYNIMD
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagaacttgaaaaaagcggatcctgagatttatgaaagtatgaaaagagagtta
aaaagacaacaaagaaatattgaattaatagcatctgaaaacatagtatcagttccagta
atggaaactatgggaagtcatcttacaaataagtatgcagaaggttactcaggcaaaaga
tattatggtggatgtgaatacatagatgaagttgaaactcttgcaatagatagaatcaaa
aaaatatttggagcagaacatgctaatgttcaacctcactctggagcaaatgcaaatatt
ggtgtatattttgctatgttaaaaccaggtgatgttgttatgggaatgaatttatctcaa
ggtggacatttaactcatggtgctccagttaatatttctggtcaatattataaattttat
gaatatggtatagataaagacagtggacttatagattttgatgaagttagaaagatagca
catgaagtaaaacctaaaatgatagttgcaggagcaagtgcatatcctagagaaatagat
tttaaaaagtttagagagatagctgatgaggttggagcattgcttatggtagatatggct
catatagcaggtcttgtggctgctggtattcaccaaaatccatgtgaagtggctgatttt
gttacaacaacaactcacaaaactttaagaggacctcgtgggggtgttattctttgtaaa
gaaaaatatgctaaagacatagacaaagcaatattccctggtattcaaggtggacctctt
gaacatataattgcttctaaggcagtttgctttaaagaagctttaagtgatgagtttaaa
gaatatcaggtacaagttgctaaaaatgcaaaagccttagctgaagaacttattaaaaga
gattttaaattgatttctggaggtacagataatcatttaatactattagatttgattaat
aaaaatataactggtaaagcagcagaaaagagattggatgatgcttatataacagctaat
aaaaatacaattccatttgatccaaatggtgctcttgttacaagtggaataagacttggt
actccagctgtaactactagaggtatgaaagaagaagatatggcaataatcgctgaggct
atagacctatgtttaacttatgatgaagaatctaaggctagaacattggttgttggttta
actgaaaaatatcctttatatgaagaatataatattatggattaa

DBGET integrated database retrieval system