KEGG   Clostridium difficile R20291: CDR20291_2695Help
Entry
CDR20291_2695     CDS       T00998                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cdl  Clostridium difficile R20291
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cdl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3186492..3187094)
Genome map
AA seq 200 aa AA seqDB search
MYSYIKGTVEEIYIDSIVVENNGIGYKINVSSNTIMNLQVGEATKIYTKLIVREDDMSLC
GFVSREELKMFELLTSVSKIGPKVALSILSFASSAQLGAYILSEDIGKLSKAPGVGKKTA
ERIVLELKDKVDKNNIEFEPTLLSQKPTLISQDESVDALVALGYTLSESKEAVQKCKKDG
MNTEAIIKKALTYIMSKSLK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtatagttatataaaaggtacagtagaagaaatttatatagacagtatagttgttgaa
aataatgggataggatataaaataaatgtatcatccaatacaataatgaatttacaagtg
ggagaagccacaaaaatatatactaaattaattgtaagagaagatgatatgagtctttgt
ggttttgtaagtagggaagaacttaagatgtttgaattactaacatctgtatctaaaata
ggacctaaggtggcgctttcaatactatcatttgcatcatcagcacagttaggagcatat
attttaagtgaagacattggaaaattatccaaagctcctggtgttggtaaaaagacagca
gaaagaatcgtcttagagcttaaggataaggtagacaaaaataacatagagtttgaacca
acgttattatcacaaaaacctaccttgatatcacaagatgagtctgtagatgcacttgta
gctttaggctatactttgtcggaatcaaaagaggcagttcaaaaatgtaaaaaagatggt
atgaatacagaagctattataaagaaagctcttacatatataatgagtaaatccttgaaa
tag

DBGET integrated database retrieval system