KEGG   Peptoclostridium difficile R20291: CDR20291_2800Help
Entry
CDR20291_2800     CDS       T00998                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cdl  Peptoclostridium difficile R20291
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cdl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CDR20291_2800 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDR20291_2800 (adhE)
   00620 Pyruvate metabolism
    CDR20291_2800 (adhE)
   00650 Butanoate metabolism
    CDR20291_2800 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    CDR20291_2800 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CDR20291_2800 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CDR20291_2800 (adhE)
   00626 Naphthalene degradation
    CDR20291_2800 (adhE)
Enzymes [BR:cdl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CDR20291_2800 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CDR20291_2800 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3314760..3317414)
Genome map
AA seq 884 aa AA seqDB search
MAHKEQVIIENKKENEVMSVGLDTVNNVESLVKKLAKIREAQKIFATYTQEQVDKIFLAA
SLAANKQRVPLAIMAQKETGMGIAEDKVIKNHYASEYIYNAYKETKTCGVIEKDEAFGMT
KIAEPIGVIAAVVPTTNPTSTAIFKALLALKTRNGIIFSPHPRAKNSTIEAAKVVLEAAV
LAGAPEGIIGWIDEPSLELTTTVMKEVDLTLATGGPGMVKSAYSSGKPAIGVGAGNTPAI
IDESADIKTAVNSILVSKTFDNGMICASEQSVIVLENIYNEVKKEFKERGAYLLDKDETE
KIRNIILVNGGLNSKIVGQTACTIAKLAGFEVPVDTKVLIGEVESVEIEEAFAHEKLSPV
LAMYKASDFDNAVRKAEKLVEDGGFGHTSSLYIDDVNQREKLDKFTSAMKTCRILINTPS
SQGGIGDLYNFKLAPSLTLGCGSWGGNSVSENVGVKHLLNIKTVAERRENMLWFRSPGKV
YFKKGCLGVALKELKDVMNKKRAFIVTDTFLYNNGYTKAVTDLLDEMNIKHTTFFEVEPD
PTLECAKIGAKAMREFNPDVIISIGGGSAMDAGKIMWTLYEHPDVDFQDLAMRFMDIRKR
VYTFPKMGEKANFVAIPTSAGTGSEVTPFAVITDQDTGVKYPLADYELMPNMAIVDSDMM
MNMPKSLTSASGIDALTHALEAYVSMLATDYTNGLALQAIKSIFEYLPRAYDNGAKDPEA
REKMANASTMAGMAFANAFLGVCHSMAHKLGAFHHVPHGVANALLITEVMKFNSSDAPKK
MGAFSQYKYPEALKRYAEIASFLGLKGNSDEEKFQSLLVAIEDLKLKVGIPKSIKEFGVE
EPKFMDSIDEMVIQAFDDQCTGANPRYPLMNEIKDMYLNSYYGR
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atggctcataaagaacaagtaataatagaaaataaaaaagaaaatgaagttatgtcagtt
ggtttagatactgtaaataacgttgaaagcttagttaaaaaactagcaaaaatcagagaa
gctcaaaaaatatttgctacatatactcaagagcaggtagataaaatttttttagcagca
tctttggcagctaataagcaaagagttcctctagctataatggcacaaaaggaaactggt
atgggaattgctgaagataaggttataaagaatcattatgcctcagagtatatatataat
gcatataaagaaactaaaacttgtggtgttatagagaaagacgaagcatttggtatgact
aaaattgctgagccaataggtgttattgcagcagttgtacctacaactaatccaacttct
actgctatctttaaagcacttttagctttaaaaactagaaatggaataattttctctccg
catccaagagcaaaaaattctactatagaggctgcaaaagttgttcttgaggctgctgtt
ttagctggagctcctgaaggcataataggatggatagatgagccatctttagaattaact
acaactgttatgaaagaagtggatttgacccttgctacaggaggtcctggaatggttaaa
tcagcatattcatctggaaaaccagctattggagttggtgcaggtaatactccagcaata
attgatgagagtgcagatataaaaactgctgtaaactcaattcttgtatctaagactttt
gacaatggtatgatatgtgcttctgaacaatcggttatagtattagaaaatatatacaat
gaagtcaaaaaagaatttaaagagcgtggtgcttatttattagataaagatgaaacagaa
aaaataagaaatataattttagtaaatggaggattaaattctaaaatagttgggcaaaca
gcttgtactatagcaaaacttgcaggctttgaagtcccagtagatactaaggttttaata
ggtgaagtagaatcagttgaaatagaagaagcttttgctcatgagaaactttcaccagta
cttgcaatgtacaaggccagtgattttgataatgcagttagaaaagcagaaaaattagta
gaagatggtggatttgggcatacatcttcattatatattgatgatgtaaatcaaagagaa
aaacttgataagtttacttcagccatgaaaacttgtagaattttaattaatactccttct
tctcaaggtggtataggggacttatataattttaaactagctccttctcttactttagga
tgtgggtcttggggtggaaattcagtatctgaaaatgtaggagttaagcatttacttaat
attaaaacagtagctgagaggagagaaaatatgctttggtttagatcaccaggaaaagtt
tatttcaaaaaaggttgtttaggggtagcattaaaagaacttaaagatgtaatgaataag
aagagagcttttattgtaacagatacattcctttacaataatggatatactaaagcagtt
actgatttattagatgaaatgaatattaagcacactacattctttgaagtagaaccagac
ccaactttggaatgtgctaagataggcgctaaagctatgagagaatttaatccagatgta
ataatatctataggtggaggaagtgcaatggatgcaggaaagataatgtggacattgtat
gagcatccagatgtagatttccaagacctagctatgagatttatggatataagaaaaagg
gtatatacattccctaaaatgggtgaaaaagctaattttgtagctataccaacatcagca
ggtactggttcagaagtaacaccatttgctgttataactgaccaagatacaggggtaaaa
tatccattagcagattatgaactgatgccaaatatggctatagttgattctgatatgatg
atgaatatgccaaaaagcttaacatctgcttctggtatagatgcattaactcatgcatta
gaagcatatgtatctatgcttgcaactgattatacaaatggattagctttacaagccatt
aagagtatatttgaatatcttccacgtgcatatgataatggtgcaaaagacccagaagct
agagaaaaaatggcaaatgcttctacaatggcaggtatggcttttgcaaatgcatttttg
ggtgtttgtcactctatggctcataaattaggtgctttccaccatgtaccacatggtgtt
gcaaatgctcttttgataacagaagttatgaaatttaattcttcagatgcaccaaagaaa
atgggagcattctctcaatataaatatccagaagcattaaaaagatatgctgaaatagct
tcatttttaggattaaagggaaattctgatgaagagaaattccaaagtttattggtagct
attgaagatttaaaacttaaagttggtattcctaaatctataaaagagtttggagttgaa
gaacctaagtttatggattcaatagatgaaatggtgattcaagcatttgatgaccaatgt
acaggagcaaatccaagatatccacttatgaatgaaataaaagatatgtatttaaattca
tattatggaagataa

  All links  
No link information was found.   
DBGET integrated database retrieval system