KEGG   Clostridium difficile R20291: CDR20291_2918Help
Entry
CDR20291_2918     CDS       T00998                                 

Gene name
ascB
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cdl  Clostridium difficile R20291
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cdl00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3457674..3459131)
Genome map
AA seq 485 aa AA seqDB search
MIKLSKFPKDFLWGGAVAANQLEGAWNEGGKGWCLADVHMYDKDRDISKHYESDMTVDKI
KFAMKDNNGYYPKRNGIDFYHTYKEDLKLLKELGLKCFRFSINWARIFPNGDDLEPNEEG
LKFYDNLINEVIDNGMEPIVTLLHYETPLNLVLKYKGWSNRKVVDFFVRYAELILNRYKD
KVKYWIVINQINLMYHESFNSVAFCVDQVDDVEEAKYQAIHHQFMATALTKKLGKEINSD
MMIGMMMADCTSYPEDCDPENVVFALKRNRIQYFFTDVSFRGEYPAYIKRFFKENNINIV
MEEGDDKVLKENTMDFLALSYYYSTTVSASKNTMNPIDNVKNQYLKANPWGWAIDPKGLY
NTLSQYYDRYQKPIMIAENGFGMHDKFEDGKVHDSYRIDYLGKHIEQIGEAIADGTEILA
YCMWSPIDIVSCSSQEMEKRYGFIYVDIDNNGNGSKERYKKDSFYWYKNVIRTNGEELKE
KVDSF
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
gtgattaaattgagtaagtttcctaaagattttttgtggggtggagctgtagcagctaat
caattagaaggtgcttggaatgaaggtggcaaagggtggtgcttagctgatgtacatatg
tatgataaagatagagatatatctaaacattacgagtctgatatgactgtagataaaata
aagtttgctatgaaagataataatgggtattatcctaagcgtaatggaatagacttttat
catacatacaaagaagatttaaagcttttgaaagaactagggttaaagtgttttagattt
tcaataaattgggctagaatatttccaaatggagatgatttagagcctaatgaagaggga
ttaaagttttatgataatcttataaatgaagtaatagataatggtatggaacctattgta
acactactccattatgagactcctttgaatttagtattaaaatataaaggatggtctaat
agaaaagtagtggatttctttgttagatatgcagaattaatattaaatagatacaaagat
aaagttaaatattggatagttataaaccaaataaatttaatgtatcatgaatcatttaat
tcagttgcattttgtgtagaccaggtagatgatgtagaagaggccaaatatcaagctatt
catcatcaattcatggctacagctttaactaagaagcttggaaaagaaataaattcagat
atgatgatagggatgatgatggcagattgtacatcttatccagaagattgcgaccctgaa
aatgtagtatttgctttaaaaagaaatagaatacaatatttttttactgatgtaagtttt
agaggggagtatccagcttatattaagagattcttcaaagaaaataacataaatatagtt
atggaagaaggtgatgataaagtgttaaaagagaatactatggattttctagctctatca
tactattactctacaacagtatcagcaagtaaaaataccatgaatccaattgataatgta
aaaaatcaatacttaaaagcaaatccttgggggtgggcaattgaccctaaaggattatac
aatactttatctcaatattatgatagatatcaaaagccaataatgatagctgaaaatgga
tttggaatgcatgataaatttgaagatggaaaagttcatgatagttatagaatagattat
ttaggaaaacatatagaacaaataggtgaagctatagctgatggaaccgaaatattagct
tattgtatgtggtcgccaatagatatagtaagttgttcatctcaagaaatggaaaaaaga
tatggatttatatatgtagatatagataacaatggaaatggaagcaaagaacgttacaaa
aaagatagtttttattggtataaaaatgtaataagaactaatggagaagaattaaaagaa
aaagtagatagtttttaa

DBGET integrated database retrieval system