KEGG   Clostridium difficile R20291: CDR20291_2948Help
Entry
CDR20291_2948     CDS       T00998                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cdl  Clostridium difficile R20291
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:cdl01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cdl01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cdl00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cdl00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cdl00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cdl00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:cdl00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3499010..3500242
Genome map
AA seq 410 aa AA seqDB search
MKGRCKMRNCIIAQSGGPTAVINASAVGIYEKNLETKYFDKVYFGINGIEGILNKNIIDS
DSLNKDNVLNLKQTPSSGLGSCRYKLADYKINSYDYDRVINILDEYEIDTLFYIGGNDSM
DTVMKFSQYCKNTTCKIKFIGIPKTIDNDLLGTDNCPGFGSAAKLISTLIMETYLDFSIY
KNNGIFIVETMGRDTGWLAASSSLARLNDTPLVDLIYLPEIDFYEDKFIEDVRKIFKEKN
KAYIVASEGIRDKYGNFICEQKTSAHDKFGHSQLGGVSNYLKNLIVSSSITTRVKTLELG
VIQRCAMHLASDTDLKQAAEVGAYGIELSKKGYTGVMAIINRTCNNPYKYEVSHTDISKI
ANKTKYFPKEWINEECNYITDEALNYLYPLIQGKPDIKYKNGLPYFSIIY
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggagatgtaaaatgagaaactgtattattgcccaatctggaggccctacagct
gttatcaatgcttctgcagttggtatttatgaaaaaaatttagaaactaaatactttgat
aaagtatattttggtatcaatgggattgaaggtatattaaacaaaaatataatagattca
gactccttaaacaaagataatgtattaaatttaaagcaaacaccttcgtctggtcttggt
tcttgtagatacaaactggctgattataaaataaattcttatgattatgatagagttata
aatatactagatgaatatgaaatagatacattattttatataggcggaaatgattctatg
gacacagtgatgaaattttctcaatactgcaaaaacactacttgtaaaataaaatttata
gggattcctaaaacaatagataatgatttattaggaactgacaactgtcctggatttggt
tctgctgcaaagcttatttctacactaataatggaaacatacttagatttttctatatac
aaaaataatggtatatttatagtagaaaccatgggtagagatactggatggttagcagct
tcttcttcactagctagacttaatgatactccacttgttgatttaatataccttccagaa
attgatttctatgaagataagtttatagaagatgttagaaaaatatttaaagaaaaaaat
aaggcttatatagttgcatcagaaggtataagggataaatacgggaactttatatgcgaa
caaaaaacttctgctcatgataaatttggtcattcccaattaggtggagtaagcaactat
ctaaagaatcttatagtatcatcatcaattacaacaagagtaaaaaccttagaacttggt
gtaatacaaagatgtgctatgcatttagcttcagatactgatttaaaacaagcagctgaa
gttggtgcatatgggatagaactatctaaaaaaggatatacaggagttatggctatcatt
aatagaacatgcaataatccttataagtatgaagttagtcatactgatatttctaaaata
gctaacaagacaaaatattttcctaaagagtggataaatgaagaatgtaattatataact
gatgaagccctaaattatctatatccacttattcaaggtaaaccagatatcaaatataaa
aatggactaccttatttttcaattatttactag

DBGET integrated database retrieval system