KEGG   Peptoclostridium difficile R20291: CDR20291_2948Help
Entry
CDR20291_2948     CDS       T00998                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cdl  Peptoclostridium difficile R20291
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cdl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CDR20291_2948
   01230 Biosynthesis of amino acids
    CDR20291_2948
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDR20291_2948
   00030 Pentose phosphate pathway
    CDR20291_2948
   00051 Fructose and mannose metabolism
    CDR20291_2948
   00052 Galactose metabolism
    CDR20291_2948
  Energy metabolism
   00680 Methane metabolism
    CDR20291_2948
Enzymes [BR:cdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CDR20291_2948
Protein phosphatases and associated proteins [BR:cdl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CDR20291_2948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3499010..3500242
Genome map
AA seq 410 aa AA seqDB search
MKGRCKMRNCIIAQSGGPTAVINASAVGIYEKNLETKYFDKVYFGINGIEGILNKNIIDS
DSLNKDNVLNLKQTPSSGLGSCRYKLADYKINSYDYDRVINILDEYEIDTLFYIGGNDSM
DTVMKFSQYCKNTTCKIKFIGIPKTIDNDLLGTDNCPGFGSAAKLISTLIMETYLDFSIY
KNNGIFIVETMGRDTGWLAASSSLARLNDTPLVDLIYLPEIDFYEDKFIEDVRKIFKEKN
KAYIVASEGIRDKYGNFICEQKTSAHDKFGHSQLGGVSNYLKNLIVSSSITTRVKTLELG
VIQRCAMHLASDTDLKQAAEVGAYGIELSKKGYTGVMAIINRTCNNPYKYEVSHTDISKI
ANKTKYFPKEWINEECNYITDEALNYLYPLIQGKPDIKYKNGLPYFSIIY
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggagatgtaaaatgagaaactgtattattgcccaatctggaggccctacagct
gttatcaatgcttctgcagttggtatttatgaaaaaaatttagaaactaaatactttgat
aaagtatattttggtatcaatgggattgaaggtatattaaacaaaaatataatagattca
gactccttaaacaaagataatgtattaaatttaaagcaaacaccttcgtctggtcttggt
tcttgtagatacaaactggctgattataaaataaattcttatgattatgatagagttata
aatatactagatgaatatgaaatagatacattattttatataggcggaaatgattctatg
gacacagtgatgaaattttctcaatactgcaaaaacactacttgtaaaataaaatttata
gggattcctaaaacaatagataatgatttattaggaactgacaactgtcctggatttggt
tctgctgcaaagcttatttctacactaataatggaaacatacttagatttttctatatac
aaaaataatggtatatttatagtagaaaccatgggtagagatactggatggttagcagct
tcttcttcactagctagacttaatgatactccacttgttgatttaatataccttccagaa
attgatttctatgaagataagtttatagaagatgttagaaaaatatttaaagaaaaaaat
aaggcttatatagttgcatcagaaggtataagggataaatacgggaactttatatgcgaa
caaaaaacttctgctcatgataaatttggtcattcccaattaggtggagtaagcaactat
ctaaagaatcttatagtatcatcatcaattacaacaagagtaaaaaccttagaacttggt
gtaatacaaagatgtgctatgcatttagcttcagatactgatttaaaacaagcagctgaa
gttggtgcatatgggatagaactatctaaaaaaggatatacaggagttatggctatcatt
aatagaacatgcaataatccttataagtatgaagttagtcatactgatatttctaaaata
gctaacaagacaaaatattttcctaaagagtggataaatgaagaatgtaattatataact
gatgaagccctaaattatctatatccacttattcaaggtaaaccagatatcaaatataaa
aatggactaccttatttttcaattatttactag

DBGET integrated database retrieval system