KEGG   Clostridioides difficile R20291: CDR20291_2948Help
Entry
CDR20291_2948     CDS       T00998                                 

Definition
(GenBank) putative phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cdl  Clostridioides difficile R20291
Pathway
cdl00010  Glycolysis / Gluconeogenesis
cdl00030  Pentose phosphate pathway
cdl00051  Fructose and mannose metabolism
cdl00052  Galactose metabolism
cdl00680  Methane metabolism
cdl01100  Metabolic pathways
cdl01110  Biosynthesis of secondary metabolites
cdl01120  Microbial metabolism in diverse environments
cdl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cdl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDR20291_2948
   00030 Pentose phosphate pathway
    CDR20291_2948
   00051 Fructose and mannose metabolism
    CDR20291_2948
   00052 Galactose metabolism
    CDR20291_2948
  Energy metabolism
   00680 Methane metabolism
    CDR20291_2948
Enzymes [BR:cdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CDR20291_2948
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     CDR20291_2948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: CBE06644
UniProt: C9YQT1
Position
3499010..3500242
Genome map
AA seq 410 aa AA seqDB search
MKGRCKMRNCIIAQSGGPTAVINASAVGIYEKNLETKYFDKVYFGINGIEGILNKNIIDS
DSLNKDNVLNLKQTPSSGLGSCRYKLADYKINSYDYDRVINILDEYEIDTLFYIGGNDSM
DTVMKFSQYCKNTTCKIKFIGIPKTIDNDLLGTDNCPGFGSAAKLISTLIMETYLDFSIY
KNNGIFIVETMGRDTGWLAASSSLARLNDTPLVDLIYLPEIDFYEDKFIEDVRKIFKEKN
KAYIVASEGIRDKYGNFICEQKTSAHDKFGHSQLGGVSNYLKNLIVSSSITTRVKTLELG
VIQRCAMHLASDTDLKQAAEVGAYGIELSKKGYTGVMAIINRTCNNPYKYEVSHTDISKI
ANKTKYFPKEWINEECNYITDEALNYLYPLIQGKPDIKYKNGLPYFSIIY
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggagatgtaaaatgagaaactgtattattgcccaatctggaggccctacagct
gttatcaatgcttctgcagttggtatttatgaaaaaaatttagaaactaaatactttgat
aaagtatattttggtatcaatgggattgaaggtatattaaacaaaaatataatagattca
gactccttaaacaaagataatgtattaaatttaaagcaaacaccttcgtctggtcttggt
tcttgtagatacaaactggctgattataaaataaattcttatgattatgatagagttata
aatatactagatgaatatgaaatagatacattattttatataggcggaaatgattctatg
gacacagtgatgaaattttctcaatactgcaaaaacactacttgtaaaataaaatttata
gggattcctaaaacaatagataatgatttattaggaactgacaactgtcctggatttggt
tctgctgcaaagcttatttctacactaataatggaaacatacttagatttttctatatac
aaaaataatggtatatttatagtagaaaccatgggtagagatactggatggttagcagct
tcttcttcactagctagacttaatgatactccacttgttgatttaatataccttccagaa
attgatttctatgaagataagtttatagaagatgttagaaaaatatttaaagaaaaaaat
aaggcttatatagttgcatcagaaggtataagggataaatacgggaactttatatgcgaa
caaaaaacttctgctcatgataaatttggtcattcccaattaggtggagtaagcaactat
ctaaagaatcttatagtatcatcatcaattacaacaagagtaaaaaccttagaacttggt
gtaatacaaagatgtgctatgcatttagcttcagatactgatttaaaacaagcagctgaa
gttggtgcatatgggatagaactatctaaaaaaggatatacaggagttatggctatcatt
aatagaacatgcaataatccttataagtatgaagttagtcatactgatatttctaaaata
gctaacaagacaaaatattttcctaaagagtggataaatgaagaatgtaattatataact
gatgaagccctaaattatctatatccacttattcaaggtaaaccagatatcaaatataaa
aatggactaccttatttttcaattatttactag

DBGET integrated database retrieval system