KEGG   Clostridioides difficile R20291: CDR20291_3028Help
Entry
CDR20291_3028     CDS       T00998                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cdl  Clostridioides difficile R20291
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cdl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDR20291_3028 (tpi)
   00051 Fructose and mannose metabolism
    CDR20291_3028 (tpi)
   00562 Inositol phosphate metabolism
    CDR20291_3028 (tpi)
Enzymes [BR:cdl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CDR20291_3028 (tpi)
Exosome [BR:cdl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CDR20291_3028 (tpi)
  Exosomal proteins of bladder cancer cells
   CDR20291_3028 (tpi)
  Exosomal proteins of melanoma cells
   CDR20291_3028 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3611301..3612044)
Genome map
AA seq 247 aa AA seqDB search
MRKPIIAGNWKMHKTIKEALEFVNEVKDKVNSDKVEAVICAPFTLLKDLKEATKGTNIKI
GAQNMHFEEKGAFTGEVSPLMLKEIDMDYVVIGHSERRQYFNETDETVNKKVLKALEVGI
DPILCVGETLEQREAGKTKDVCKVQVEKALENVLKDDLSKVVVAYEPIWAIGTGKTATAE
DANDVISYIREVIKGLYGELANEVRIQYGGSVKPSNVAEIMGQSDIDGALVGGASLASND
YLDLVNF
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacctataattgcaggaaactggaaaatgcataaaacaataaaagaagcttta
gaatttgtaaatgaagttaaagataaagtaaattctgataaagtagaagctgttatatgt
gcaccatttactttattaaaggatttaaaagaagctactaagggtacaaatataaagata
ggtgctcaaaatatgcactttgaagaaaaaggagcatttacaggagaagtttcacctctt
atgttaaaagaaatagatatggactatgttgtaataggacattcagaaagaagacaatac
ttcaatgaaactgatgaaactgtaaacaagaaagttttaaaagcattagaagtaggaata
gacccaatattatgtgttggagaaactttagaacaaagagaagctggaaaaactaaagat
gtttgtaaagttcaagttgaaaaagctttagaaaatgttcttaaagatgatttatcaaaa
gtagttgttgcatatgagccaatctgggctattggaactggtaaaactgcaactgctgaa
gatgctaatgacgttatatcttatataagagaagttataaaaggattatatggagaatta
gctaatgaagttagaatacaatacggtggaagtgttaaaccttcaaatgtagccgaaata
atgggtcaaagtgatatagatggagctttagtaggtggagctagtttagctagtaatgat
tacctagaccttgttaatttctaa

DBGET integrated database retrieval system