KEGG   Peptoclostridium difficile R20291: CDR20291_3217Help
Entry
CDR20291_3217     CDS       T00998                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cdl  Peptoclostridium difficile R20291
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cdl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CDR20291_3217 (pfkA)
   01230 Biosynthesis of amino acids
    CDR20291_3217 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDR20291_3217 (pfkA)
   00030 Pentose phosphate pathway
    CDR20291_3217 (pfkA)
   00051 Fructose and mannose metabolism
    CDR20291_3217 (pfkA)
   00052 Galactose metabolism
    CDR20291_3217 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CDR20291_3217 (pfkA)
Enzymes [BR:cdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CDR20291_3217 (pfkA)
Protein phosphatases and associated proteins [BR:cdl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CDR20291_3217 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3836219..3837178)
Genome map
AA seq 319 aa AA seqDB search
MKTIGLLTSGGDAPGMNAAIRAVVRSAIYYGCKVYGINRGYKGLLEEDLTEMNLSSVGDI
IHRGGTILKSSRCEEFKTEEGRLKAVKILKKYKIDCLVVIGGDGSFAGAQKLSDLGFPAI
GIPGTIDNDLAYTDYTIGFDTAMNTIIDAIGKIRDTSSSHERVNIVEVMGRHCGDLALYA
GLAGGAETIIVPEVEITVDEVALRLKTTQKRGKRHSIIVLAEGVGSASDLEKELKKESGA
DLRVTVLGHVQRGGSPTVSDRILASRLGVRAVELLLDGKSARVVGIKENKIIDLEISEAL
AQKKVFDKEAYEMAKILSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactataggattactaacaagtggaggagatgctccaggaatgaatgctgcgatt
agagcggttgtaagatcagcaatatattatggatgcaaagtatatggaatcaatagagga
tataagggattactagaagaagatttaactgaaatgaacttatcttctgttggagatatt
atacacaggggaggaactatattaaaatcttccagatgtgaagaatttaaaacagaagaa
ggtagattaaaagcagtaaaaattcttaaaaagtataaaattgattgcttagttgtaatt
ggtggagatggttcatttgcaggagcccaaaaacttagtgacttaggattcccagctata
ggcataccaggaactatagataacgatttagcatatacagattatactataggatttgat
actgcaatgaatactattatagatgctataggtaagataagagatacatcatcatctcat
gaaagagttaacatagtagaagttatgggaagacactgtggagatttagctttatatgca
ggtcttgcaggaggagcggaaactataatagtaccagaagtagaaattacagtagatgaa
gttgctctaagattaaagactactcaaaaaagaggtaagagacatagtataatcgtttta
gcagaaggagtcggaagtgctagtgatttagaaaaggaacttaaaaaagagtcaggagca
gatttaagagtcactgtattggggcatgtccaaagaggaggaagcccaactgtatctgat
agaatactagcaagtagacttggagtaagagcagtagaattattattagatggaaaatca
gctagagttgtaggaataaaagaaaacaaaataattgatttagaaataagtgaagcttta
gctcaaaagaaagtatttgataaagaagcttatgagatggcaaaaatattatctatataa

DBGET integrated database retrieval system