KEGG   Peptoclostridium difficile R20291: CDR20291_3242Help
Entry
CDR20291_3242     CDS       T00998                                 

Gene name
hemD
Definition
bifunctional uroporphyrinogen-III methyltransferase/uroporphyrinogen-III synthase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cdl  Peptoclostridium difficile R20291
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CDR20291_3242 (hemD)
Enzymes [BR:cdl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CDR20291_3242 (hemD)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CDR20291_3242 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3876506..3878005)
Genome map
AA seq 499 aa AA seqDB search
MKGKVYLVGAGPGDYKLMTLKGLECIRKSDVIVYDRLANSSYLREAKPDCELIYVGKASS
NHILPQEDINRIIAEKAKEGKIVTRLKGGDPYVFGRGGEEAETLVDEDIEFEVVPGITSA
IGGLCYAGIPITHRDHASSFHVITGHLKGDDSGELNWNALANNKGTLVFLMGISNLEKIS
ENLMKEGKDKDTPVALISWATRYNQRVVTSTLENVYETAIKEEVKPPTLIVVGSVVGLRE
KLNFFESKPLFGKSIAVTRSRNQNSVLVEKIMDLGGNPIEIPTIKVEKIQNNINLENEIK
NINKYNYLILTSKNAVEIFFEKIYEMNFDLRILSNLKVCAIGSATSNELKKRGIIADIVP
KKFVAESLYEELAPILNDNDNILIPRAENARDYLVDKLKAICEVTEVHIYRTVIDEDKKG
EILDILNSNDIDYITFTSSSTVNNLVEIIGKENIKILEKIKTLSIGPITTETINSLGIKL
YKESATSTIDSLVDLIIKN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtaaggtttacttagtaggggcaggaccaggtgattataaactcatgacttta
aaaggtttagagtgtataagaaaatcggatgtaatagtatatgatagattagcaaatagt
agttatttaagagaagctaagcctgattgtgaacttatatatgtaggcaaggcatcaagt
aatcatattttgccacaagaagatataaatagaattatagcagaaaaagctaaagaagga
aaaattgtaactcgtcttaaaggaggagacccttatgtatttggcagagggggagaagaa
gcagagactttagtagatgaagatatagaatttgaagtagttccaggtataacttctgct
ataggaggtttatgttatgcgggtattcctataacacatagagaccatgcttcgtcattt
catgtaataacaggtcatttgaagggtgatgatagtggagaattaaactggaatgctctt
gcaaataacaaaggtactcttgtgtttttgatgggaatttcaaacctagagaaaataagt
gaaaacttaatgaaagaaggaaaagataaggatacacctgttgctcttataagttgggca
actagatataatcaaagagttgttacatctacacttgagaatgtttatgaaactgctatt
aaagaagaagtaaaaccgccaactcttatagtagttgggagtgttgtaggacttagagaa
aagttgaacttctttgaaagtaagcctttatttggaaaaagtattgctgtaactaggtct
agaaatcaaaatagtgtattggtagaaaaaataatggatttaggtggaaatcctatagaa
atacctactattaaggtagaaaaaatacaaaataatattaacttagaaaatgaaataaaa
aatataaataagtataattatttaatactaactagtaaaaatgccgtagaaatcttcttt
gaaaagatatatgaaatgaattttgatttaaggatattatctaatttaaaggtatgtgct
ataggttctgctacatcaaatgagttgaaaaaaagaggaattatagcggatatagtacca
aaaaaatttgtagcagagtcactgtatgaagagttagctcctattttaaatgataacgat
aatatacttatacctagagcagaaaatgctagagattatctggttgacaaacttaaggct
atttgtgaagtaacagaagtacatatatatagaacagtaatagatgaggataaaaaaggt
gagatattagatattttaaattctaatgatatagattatataacatttactagttcctca
acagtaaataatcttgttgaaattataggaaaagaaaatattaaaatattagaaaaaata
aaaacactatctataggtcctataactacagagacaataaatagtttgggaataaaattg
tacaaagaatctgctacatctactatagattcgttagtagatttaattataaaaaattaa

DBGET integrated database retrieval system