KEGG   Clostridium difficile R20291: CDR20291_3325Help
Entry
CDR20291_3325     CDS       T00998                                 

Gene name
gtaB
Definition
utp--glucose-1-phosphate uridylyltransferase (general stress protein 33)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cdl  Clostridium difficile R20291
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:cdl00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cdl00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cdl00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cdl00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3957235..3958200)
Genome map
AA seq 321 aa AA seqDB search
MQVKVKKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTLQYIIEEAVASGIEEILIITGR
NKKSIEDHFDKSVELELDLEKKGKKELLEVVQNISNMINIHYIRQKEPKGLGDAIYCARH
FIGDEPFAVMLGDDIVDNDVPCLKQLTDAYEEYRTTILGVQKVNQEDTNKYGIIEAKNIE
GRVYKVKDMVEKPESGKAPSNIAILGRYIITPEIFDILKDLPPGKGGEVQLTDALKILSK
KEAMYAYNFEGKRYDVGDKLGFLEATVDFALKKEDLKEDFIKYLKHVCSEFDKNNNVLYN
NTDEKIDLIEVNEARELEIQK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttaaagttaaaaaggctgtaataccagcagcaggtttaggaactagatttttg
ccagctacaaaggcacaaccaaaagagatgttaccaatagttgataagccaactctacaa
tacataatagaagaagctgtggcctcaggaatagaggaaatactaataataacaggtaga
aataaaaaatctattgaagaccactttgataaatctgtagaattggaacttgatttagag
aaaaaaggtaagaaagaattgttggaggtagtacaaaacatatctaacatgattaacata
cattatataagacaaaaagagccaaaaggattgggagatgcaatttattgtgcgaggcat
tttataggtgatgagccgtttgcagtaatgttaggggatgatattgtagataatgatgta
ccttgtctaaaacaactaacagatgcatatgaggaatatagaactacaatattgggtgtt
caaaaggtaaatcaagaagatactaataaatatgggataatagaagcaaaaaatatagaa
ggtagagtttacaaggtaaaagacatggtagaaaagccagagtcaggaaaagctccttca
aatattgctattttaggtagatatataataactcctgaaatctttgatattcttaaggat
ttaccaccaggtaaaggtggagaggtacaacttacagatgctttaaaaatattatctaag
aaagaagctatgtatgcatacaattttgaaggcaagagatatgatgttggggacaagcta
ggatttttagaagctactgttgactttgctctaaagaaagaagaccttaaggaagatttt
ataaaatatttgaaacatgtatgtagtgaatttgataaaaataacaatgtgttatacaat
aatacagatgaaaaaatagatttaattgaagtcaatgaagctagagaacttgaaattcaa
aaataa

DBGET integrated database retrieval system