KEGG   Peptoclostridium difficile R20291: CDR20291_3403Help
Entry
CDR20291_3403     CDS       T00998                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cdl  Peptoclostridium difficile R20291
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CDR20291_3403 (ipk)
Enzymes [BR:cdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CDR20291_3403 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4045096..4046016)
Genome map
AA seq 306 aa AA seqDB search
MHYSLNKEDRMDFIRLKSRAKINLSIDVLGKRQDGYHFVEMIMQTIDLYDIVKIKELDED
EIKVKSTSLDIPLDEDNIVYKAAKILKNKFYIKKGVEIFIEKNIPVAAGMAGGSSNAAAV
LVGLNHLWELRLSEDELKEIGLNLGADVPFCISGRPALAQGIGEKLTNIKGLPCDTNILI
CKPDLFVSTKEVYQGLDLNNIKKRPNNKYLIECLKSEDIKAVSESMVNILENVTIGKHKE
ISDIKQVMMKNNALGSMMSGSGPTVFGLFKNKEDALIGKKELLKKYKQVYVVNSSQKGVE
ICGEFN
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcattattctttaaacaaggaggatagaatggattttataagactaaagagtagagca
aaaataaatttatccattgatgtcttgggaaaaaggcaagacggttatcattttgttgaa
atgataatgcaaacgatagatttatacgatatagtaaagataaaagaattagacgaagat
gaaataaaggtaaaaagcactagtttagatattcctttagatgaagataatattgtttat
aaagctgccaaaatacttaaaaataaattttatataaaaaaaggtgtagaaatattcata
gaaaaaaatattcctgtagcagcagggatggctggaggaagttctaatgcagccgcagta
ttagtaggtttaaatcacctatgggaacttagattatctgaagatgaattaaaagaaata
ggacttaatttgggcgcagatgttcctttttgtatatcaggaagacctgccttagctcaa
ggtattggagaaaagctaacaaacatcaaaggtttaccatgtgatacaaatatattgata
tgcaaaccagacttattcgtttctactaaagaagtttatcaaggattagatttgaataat
attaaaaaaagaccaaataataaatatttgatagagtgtttaaaatctgaagatataaaa
gctgtatcagaaagcatggtaaatattcttgaaaatgttactataggtaaacacaaagaa
ataagtgatataaaacaagtaatgatgaaaaataatgctttaggttctatgatgagtgga
agtggtcctacagtttttggactatttaaaaataaagaagatgctctaattggaaaaaaa
gaattattaaaaaaatataaacaggtgtatgttgttaatagcagtcaaaaaggggttgaa
atttgtggagaatttaactaa

DBGET integrated database retrieval system