KEGG   Clostridium difficile R20291: CDR20291_3403Help
Entry
CDR20291_3403     CDS       T00998                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cdl  Clostridium difficile R20291
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cdl00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4045096..4046016)
Genome map
AA seq 306 aa AA seqDB search
MHYSLNKEDRMDFIRLKSRAKINLSIDVLGKRQDGYHFVEMIMQTIDLYDIVKIKELDED
EIKVKSTSLDIPLDEDNIVYKAAKILKNKFYIKKGVEIFIEKNIPVAAGMAGGSSNAAAV
LVGLNHLWELRLSEDELKEIGLNLGADVPFCISGRPALAQGIGEKLTNIKGLPCDTNILI
CKPDLFVSTKEVYQGLDLNNIKKRPNNKYLIECLKSEDIKAVSESMVNILENVTIGKHKE
ISDIKQVMMKNNALGSMMSGSGPTVFGLFKNKEDALIGKKELLKKYKQVYVVNSSQKGVE
ICGEFN
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcattattctttaaacaaggaggatagaatggattttataagactaaagagtagagca
aaaataaatttatccattgatgtcttgggaaaaaggcaagacggttatcattttgttgaa
atgataatgcaaacgatagatttatacgatatagtaaagataaaagaattagacgaagat
gaaataaaggtaaaaagcactagtttagatattcctttagatgaagataatattgtttat
aaagctgccaaaatacttaaaaataaattttatataaaaaaaggtgtagaaatattcata
gaaaaaaatattcctgtagcagcagggatggctggaggaagttctaatgcagccgcagta
ttagtaggtttaaatcacctatgggaacttagattatctgaagatgaattaaaagaaata
ggacttaatttgggcgcagatgttcctttttgtatatcaggaagacctgccttagctcaa
ggtattggagaaaagctaacaaacatcaaaggtttaccatgtgatacaaatatattgata
tgcaaaccagacttattcgtttctactaaagaagtttatcaaggattagatttgaataat
attaaaaaaagaccaaataataaatatttgatagagtgtttaaaatctgaagatataaaa
gctgtatcagaaagcatggtaaatattcttgaaaatgttactataggtaaacacaaagaa
ataagtgatataaaacaagtaatgatgaaaaataatgctttaggttctatgatgagtgga
agtggtcctacagtttttggactatttaaaaataaagaagatgctctaattggaaaaaaa
gaattattaaaaaaatataaacaggtgtatgttgttaatagcagtcaaaaaggggttgaa
atttgtggagaatttaactaa

DBGET integrated database retrieval system