KEGG   Castellaniella defragrans: BN940_03926Help
Entry
BN940_03926       CDS       T03058                                 

Definition
Phosphoenolpyruvate carboxylase (EC:4.1.1.31)
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cdn  Castellaniella defragrans
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cdn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN940_03926
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN940_03926
  Energy metabolism
   00680 Methane metabolism
    BN940_03926
Enzymes [BR:cdn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BN940_03926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(856745..859546)
Genome map
AA seq 933 aa AA seqDB search
MLGRTLGEVIRDCEGRAVYDVIEKLRRAAVKFRREGLDRDGRMLERQIRRLADGEANSVA
RAFSYFLHLSNIAEDRDQTRRQRRQWQAEGPAVPGSLRHAVDLLQAAGLSGARIRQHLAS
ACIVPVLTAHPTEVQRKSTLDLHQAIAGHLRQLDTPHAPLEAARLQERLAGLIAALWQTR
MLRQSKLTVLDEIDNALSYYTSTFFSTLPQLHLDMGTLLRKPARTVFDVDNTPLPPFVHM
GSWIGGDRDGNPNVDAGTLEQALLRQCAHVLRHYLTEVHALGAELSVSQSLMHVTPALAE
LAAASRDPSPHRQDEPYRRACIHIYARLAATAQALTGRRLARRTIYDAPAYGSAAELAAD
LRIVAESLDAHHGALVARLRLTHLRQAVEIFGLHLATVDLRQSSDVHERVLDELMRHARV
TLDGKPVRYARLPEADRVRVLRQELREPRPLVSPWIEYSAETTKELAILRMAADCRRRFG
KAALRQTIVSHTETLSDLLEVLVLQQETGLIAPTAANDAEPDSGLMVVPLFETIPDLERG
PDIMDAWLSLPEVAARVRHAQHGIQEVMLGYSDSNKDGGYLTSNWSLYQAERRLVEVFRR
HRTRLRLFHGRGGSVGRGGGPSYDSILSQPPGTVNNQIRLTEQGEIIQGRYKDAEVGRSH
LELFVAATLEASLASGSPASRAEDDHAARYGEAMAWMSETARHAYRDLVYGTEGFTDYFF
ASTPIREIAGLNIGSRPSSRKALQRIEDLRAIPWSFSWAQCRLPLPGWYGMGTALRRYLA
EGGPDQALPQEERLRRLQAMARDWPFFRTLLSNMEQVLAKTDLAIGRAYAELVPDKALRK
RIFERIAAEYQATLDAFRTVTGHDLLAHDEPLRSALAERFAYIDPLNHLQVELLRRVRSG
HASARRADEQESRDQRAIHMTINGIAAGLRNSG
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgctgggccggacgctgggggaggtcatccgggactgcgaggggcgcgccgtctacgac
gtgatcgaaaaactgcgccgcgcggcggtgaagttccgccgcgagggcctggaccgcgac
ggccgcatgctggagcgccagatccgccgcctggccgacggcgaggccaattccgtggcg
cgcgccttcagctacttcctgcacctgtccaacatcgccgaggaccgcgaccagacccgc
cgccagcgccggcagtggcaggccgaaggccccgccgtcccgggcagcctgcggcacgcc
gtcgatctgctgcaggccgccggcctgtccggcgcccgcatccgccagcacctggcctcg
gcctgcatcgtgcccgtgctgacggcgcaccccaccgaagtccagcgcaagagcacgctg
gacctgcaccaggccatcgccgggcacctgcgccagctggacacgccgcacgcgccgctg
gaagccgcccggctgcaggaacgcctggccggcctgatcgccgccctgtggcagacccgc
atgctgcgccagagcaagctcaccgtgctcgacgagatcgacaacgccctgtcctactac
accagcaccttcttcagcaccctgccccagctccacctggacatgggcacgctgctgcgc
aagccggcgcgcaccgtgttcgacgtggacaacacgccgctgccgcccttcgtccacatg
ggcagctggatcggcggcgaccgcgacggcaacccgaacgtggacgccggcacgctggag
caggcgctgctgcgccagtgcgcgcacgtgctgcgccactacctgaccgaagtccacgcc
ctgggcgccgagctgtccgtctcgcagtccctgatgcacgtcaccccggccctggccgag
ctggccgccgccagccgcgacccttcgccccaccgccaggacgagccctaccggcgcgcc
tgcatccacatctatgcccggctcgccgccaccgcgcaggccctgaccggccggcgcctg
gcccggcgcaccatctacgacgccccggcctacggctcggccgccgaactcgccgcggac
ctgcgcatcgtggccgagtcgctggacgcgcaccacggcgccctggtcgcgcggctgcgc
ctgacgcacctgcgccaggcggtcgagatcttcggcctgcacctggccacggtggacctg
cggcagagctccgacgtgcacgagcgcgtgctcgacgagctgatgcgccacgcccgcgtg
accctggacggcaagccggtgcgctacgcccggctgcccgaggccgaccgcgtccgcgtg
ctgcgccaggaactgcgcgagccgcgtcccctggtgtcgccctggatcgaatattcggcc
gagaccaccaaggaactggccatcctgcgcatggccgccgactgccgccgccgcttcggc
aaggccgccctgcgccagaccatcgtgtcccataccgagactctcagcgacctgctggaa
gtcctggtgctgcagcaggaaaccggcctgatcgcgccgaccgcggcgaacgacgccgag
cccgacagcgggctgatggtggtgccgctgttcgagaccatccccgacctggagcgcggg
ccggacatcatggacgcctggctgtcgctgcccgaggtcgccgcgcgcgtgcgccacgcc
cagcacggcatccaggaagtcatgctgggctattccgacagcaacaaggacggcggctac
ctgacctcgaactggtcgctctaccaggccgagcggcgcctggtcgaagtcttccgcagg
caccgcacccgcctgcgcctgttccacgggcgcggcggctccgtgggccggggcggcggc
cccagctacgactccatcctgtcgcagcccccgggcaccgtgaacaaccagatccgcctc
accgaacagggcgagatcatccagggccgctacaaggacgccgaggtcgggcgctcgcac
ctggagctcttcgtcgccgccacgctggaggccagcctggcgtccggatcgccggccagc
cgcgccgaggacgaccacgccgcccgctacggcgaggccatggcctggatgtcggagacc
gcccggcacgcctaccgcgacctggtctacggcacggaaggcttcacggactatttcttc
gcctcgacgccgatccgcgagatcgccggcctgaacatcggctcgcgcccgtcctcgcgc
aaggccctgcagcgcatcgaggacctgcgcgcgatcccctggtcgttctcctgggcccag
tgccgcctgcccctgcccggctggtacggcatgggcacggcgctgcggcgctacctggcc
gagggcggccccgaccaggccctgccgcaagaagaacgcctgcggcgcctgcaggccatg
gcgcgcgactggccgttcttccgcaccctgctgtccaacatggagcaggtgctggccaag
accgacctcgccatcggccgcgcctacgccgaactggtgcccgacaaggccctgcgcaag
cgcatcttcgagcgcatcgccgccgaataccaggccacgctggacgccttccgcaccgtc
accggccacgacctgctggcgcacgacgagcccctgcgcagcgccctggccgagcgcttc
gcctacatcgacccgctcaaccacctgcaggtcgagctgctgcgccgcgtgcgctccggc
cacgcctccgcgcgccgcgccgacgagcaggaatcgcgcgaccagcgcgcgatccacatg
accatcaacggcatcgccgccgggctgaggaattcgggatga

DBGET integrated database retrieval system