KEGG   Castellaniella defragrans: BN940_13056Help
Entry
BN940_13056       CDS       T03058                                 

Definition
Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC:2.6.1.19)
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
cdn  Castellaniella defragrans
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdn00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN940_13056
   00650 Butanoate metabolism
    BN940_13056
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN940_13056
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN940_13056
Enzymes [BR:cdn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BN940_13056
Amino acid related enzymes [BR:cdn01007]
 Aminotransferase (transaminase)
  Class III
   BN940_13056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
2823004..2824266
Genome map
AA seq 420 aa AA seqDB search
MTQHNQDWQVRKNAAIPDGIGIACDFYASRALNAELWDVEGRRYIDFAAGIAVANTGHRH
PRIVQAIRAQLDAFTHTAFQVAPYGSYVELAERINRLAPGAHSKKTAFFTTGAEALENAV
KIARAATGRTGIVAFSGAFHGRTFMGMALTGKVAPYKQDFGPLPAEVYHIPFPTPLDGVT
TQDSLRALDLLFKADISPQRVAAIVIEPVQGEGGFNVAPPELLRALRERCDAHGILLIAD
EVQTGFARTGRMFAIEHSGVTPDLITMAKSLAGGMPLSGVCGRAELMDAAPRGSLGGTYA
GNPLAIAAALAVLDVIDAEGLIARAEALGQRLRQALAGFGHPRVAEIRGLGAMVAAEFRQ
PDGRPDPDTAARIQRRALERGLVLLTCGAYGQVIRFLFPLTIPDGLLEEGLAILRESMAG
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaacacaaccaggactggcaggtccgcaagaacgcggccatccccgacggcatc
ggcatcgcctgcgatttctatgccagccgcgcgctgaacgccgaactgtgggacgtggaa
ggccggcgctacatcgacttcgcggccggcatcgccgtggccaacaccggccaccgccac
ccgcgcatcgtacaggccatccgcgcgcagctggacgccttcacccacaccgcctttcag
gtcgcgccctacggctcctacgtggaattggccgagcgcatcaaccgcctggcgcccggc
gcgcactccaagaagaccgccttcttcacgaccggcgccgaggccctggaaaacgccgtc
aagatcgcgcgcgccgccaccggccgcaccggaatcgtggccttctccggggccttccat
ggccgcaccttcatgggcatggccctgaccggcaaggtcgccccctacaagcaggacttc
ggcccgctgccggccgaggtctaccacatccccttccccactccgctggacggcgtcacc
acgcaggattcgctgcgggcgctggacctgctgttcaaggccgacatcagcccgcagcga
gtggcggccatcgtcatcgagccggtccagggcgaaggcggattcaacgtcgccccgccg
gaactcctgcgggcgctgcgcgaacgctgcgacgcccacggcatcctgctcatcgccgac
gaggtccagaccggcttcgcccgcacgggccggatgttcgccatcgagcattcgggcgtg
acgcccgacctgatcaccatggccaagagcctggcgggcggcatgccgctgtccggcgtc
tgcggccgcgccgaactgatggatgccgcgccgcgcggttcgctgggcggcacctacgcg
ggcaatccgctggccatcgccgccgccctggccgtgctggacgtgatcgacgcagagggc
ctgatcgcgcgcgccgaggccctgggccagcgcctgcgccaggcgctggccgggttcggg
cacccgcgcgtggccgagatccgcggcctgggcgccatggtggccgccgaattccgccag
cccgacggccggcccgaccccgacaccgccgcccgcatccagcgccgcgccctggagcgc
gggctggtcctgctgacctgcggcgcctacggccaggtcatccggttcctctttcccctg
acaatccccgatggcctgctggaggaaggactggctatcctccgggaatccatggccggc
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system