KEGG   Corynebacterium diphtheriae 241: CD241_0205Help
Entry
CD241_0205        CDS       T01687                                 

Gene name
tgt
Definition
queuine tRNA-ribosyltransferase
Orthology
K00773  
queuine tRNA-ribosyltransferase [EC:2.4.2.29]
Organism
cdp  Corynebacterium diphtheriae 241
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
183026..184318
Genome map
AA seq 430 aa AA seqDB search
MTDTTFELRTELDDAPGRHGRTGVIHTPHGDINTPAFIPVATKATVKTLTPQQIRDTGAQ
AILSNAYHLYLQPGPDIVDEAGGVSKFENWHGPTYTDSGGFQVMSLGVGFRKVLAMDTAG
LVEGDIRAPKKDRYAQVDEDGVDFRSVIDGSRHRFTPEISMQIQHQLGADIIFAFDELTT
LVDTRQYQESSVERTHRWARRCLIEHDRLTREREGKPLQSLWGVVQGAQYEDLRRQAIRG
LLDLDKEAEDNGRRGFGGFGIGGALEKENLGTIVGWVCDEIPQHKPRHLLGISEPDDLFT
AIEAGADTFDCVAPTRLGRRGGVYTLDGRVNLTAARFKRDFRQVDEEFGGPIAEYSRAYI
HHLFKAKEFLGGTLCTMHNVAFMIQLVDNIRAAINNGDFEAYRDEFLGRYYASKGGPAAA
GRSGGMIYGV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgactgacacgacttttgagcttcgtaccgagctggacgacgcgccgggccgccacggc
cgtactggtgtaatccatacccctcatggagacatcaacacgccggcgttcatccctgtg
gccaccaaggcgacggtgaaaaccctcaccccacagcaaattcgtgacactggcgcccag
gcgatcctctccaacgcctaccacctttacttgcagccgggccccgatattgtcgatgaa
gccggtggtgtatccaagttcgagaactggcacggccccacctacaccgactccggtgga
ttccaggtgatgagccttggtgttggttttagaaaagttcttgccatggataccgcgggg
cttgtagaaggcgacatccgcgcgcctaaaaaagatcgctacgcgcaggttgatgaagac
ggcgtggacttccgcagcgttatcgacggctcccgccaccgcttcaccccggaaatcagc
atgcagatccagcatcagctgggtgccgacatcatctttgctttcgacgagctgaccacc
ctcgtggacacccgccagtaccaagaaagctccgtcgaacgcactcaccgctgggcacgc
cgctgcctcatcgaacacgaccgcctcacccgcgaacgcgaaggaaaaccactgcaatcc
ctgtggggtgttgtccaaggtgctcagtacgaggacctgcgtcgacaagcgattcgtggc
ctgcttgacctagacaaagaggcagaagataacggacgacgcggcttcggtggcttcggc
atcggtggcgcattagaaaaggaaaacctaggaaccatcgtaggctgggtgtgcgacgaa
atcccgcagcataaaccacgccacctactgggaatcagcgaaccagacgacctcttcacc
gccatcgaagcaggtgccgacaccttcgactgtgttgcaccgacgcgcctcggccgtcgc
ggtggcgtgtacaccctcgacgggcgcgtgaacctcaccgcagcccgcttcaagcgtgac
ttccgccaagtagacgaggaatttggcggccccatcgccgagtactcccgcgcctacatt
caccacctgtttaaggccaaggaattcctcggtggaacattgtgcacaatgcacaacgtg
gcctttatgatccagctggtagacaacattcgcgccgccatcaacaacggcgactttgag
gcataccgcgatgaatttctcggccgctactacgcaagcaaaggaggcccagcggcagct
gggcgctccggaggaatgatctacggggtttag

DBGET integrated database retrieval system