KEGG   Corynebacterium diphtheriae 241: CD241_0327Help
Entry
CD241_0327        CDS       T01687                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cdp  Corynebacterium diphtheriae 241
Pathway
cdp00010  Glycolysis / Gluconeogenesis
cdp00260  Glycine, serine and threonine metabolism
cdp00680  Methane metabolism
cdp01100  Metabolic pathways
cdp01110  Biosynthesis of secondary metabolites
cdp01120  Microbial metabolism in diverse environments
cdp01130  Biosynthesis of antibiotics
cdp01200  Carbon metabolism
cdp01230  Biosynthesis of amino acids
Module
cdp_M00002  Glycolysis, core module involving three-carbon compounds
cdp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cdp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD241_0327 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CD241_0327 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CD241_0327 (gpmA)
Enzymes [BR:cdp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CD241_0327 (gpmA)
Membrane trafficking [BR:cdp04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CD241_0327 (gpmA)
Exosome [BR:cdp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CD241_0327 (gpmA)
  Exosomal proteins of melanoma cells
   CD241_0327 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEX43394
Position
314157..314903
Genome map
AA seq 248 aa AA seqDB search
MTTGKLILLRHGQSEWNASNQFTGWVDVNLTEKGEAEAKRGGELLKAQGVLPSVVYTSLL
RRAIRTANIALNAADRHWIPVVRDWRLNERHYGALQGLNKAETKEKYGDEQFMAWRRSYG
TPPPELEDSSEFSQANDPRYANLDVVPRTECLKDVVERFVPYFKEEILPRVQNGETVLIA
AHGNSLRALVKHLDNISDADIAELNIPTGIPLVYELDEAGTVLNPGGTYLDPEAAAAGAA
AVAAQGAK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgactactggaaaactgattcttcttcgtcacggacaaagcgaatggaacgcttccaac
cagttcaccggctgggtggacgtcaacctcaccgaaaagggcgaggcagaggctaagcgc
ggcggcgaactgctcaaggctcagggggtcctgccaagcgtggtgtacacctctttgctg
cgccgtgctatccgcaccgccaacattgctctgaacgctgctgatcgccactggatccca
gttgttcgcgattggcgcctcaacgagcgccactacggtgcgctgcagggcctgaataag
gctgagactaaggaaaagtacggcgacgagcagttcatggcatggcgtcgttcttatggc
accccaccaccagagcttgaggattccagcgagttctcccaggcaaacgatcctcgttac
gccaaccttgacgtggttcctcgcaccgagtgcttgaaggacgttgttgagcgtttcgtt
ccttacttcaaggaagagatcctgccacgtgtacagaacggtgagactgttttgatcgct
gcacacggtaactccctgcgtgcattggtcaagcacctagacaacatctctgatgcagac
atcgctgagctcaacatccctaccggtattccactggtttatgagctcgacgaggctggc
acggtgctcaacccaggtggcacctaccttgacccagaagctgctgctgctggtgctgcc
gcagttgctgctcagggcgctaagtag

DBGET integrated database retrieval system