KEGG   Corynebacterium diphtheriae 241: CD241_0327Help
Entry
CD241_0327        CDS       T01687                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cdp  Corynebacterium diphtheriae 241
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cdp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CD241_0327 (gpmA)
   01230 Biosynthesis of amino acids
    CD241_0327 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD241_0327 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CD241_0327 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CD241_0327 (gpmA)
Enzymes [BR:cdp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CD241_0327 (gpmA)
Exosome [BR:cdp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CD241_0327 (gpmA)
  Exosomal proteins of melanoma cells
   CD241_0327 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
314157..314903
Genome map
AA seq 248 aa AA seqDB search
MTTGKLILLRHGQSEWNASNQFTGWVDVNLTEKGEAEAKRGGELLKAQGVLPSVVYTSLL
RRAIRTANIALNAADRHWIPVVRDWRLNERHYGALQGLNKAETKEKYGDEQFMAWRRSYG
TPPPELEDSSEFSQANDPRYANLDVVPRTECLKDVVERFVPYFKEEILPRVQNGETVLIA
AHGNSLRALVKHLDNISDADIAELNIPTGIPLVYELDEAGTVLNPGGTYLDPEAAAAGAA
AVAAQGAK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgactactggaaaactgattcttcttcgtcacggacaaagcgaatggaacgcttccaac
cagttcaccggctgggtggacgtcaacctcaccgaaaagggcgaggcagaggctaagcgc
ggcggcgaactgctcaaggctcagggggtcctgccaagcgtggtgtacacctctttgctg
cgccgtgctatccgcaccgccaacattgctctgaacgctgctgatcgccactggatccca
gttgttcgcgattggcgcctcaacgagcgccactacggtgcgctgcagggcctgaataag
gctgagactaaggaaaagtacggcgacgagcagttcatggcatggcgtcgttcttatggc
accccaccaccagagcttgaggattccagcgagttctcccaggcaaacgatcctcgttac
gccaaccttgacgtggttcctcgcaccgagtgcttgaaggacgttgttgagcgtttcgtt
ccttacttcaaggaagagatcctgccacgtgtacagaacggtgagactgttttgatcgct
gcacacggtaactccctgcgtgcattggtcaagcacctagacaacatctctgatgcagac
atcgctgagctcaacatccctaccggtattccactggtttatgagctcgacgaggctggc
acggtgctcaacccaggtggcacctaccttgacccagaagctgctgctgctggtgctgcc
gcagttgctgctcagggcgctaagtag

DBGET integrated database retrieval system