KEGG   Corynebacterium diphtheriae 241: CD241_0347Help
Entry
CD241_0347        CDS       T01687                                 

Gene name
hemG
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cdp  Corynebacterium diphtheriae 241
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cdp00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
333298..334650
Genome map
AA seq 450 aa AA seqDB search
MRIAIIGAGLAGLTAAYRLRDHDVSVFEATDRIGGKLHTVAFQSGPTDMGAEAYLAFRED
TTAFFKELGLEVVSPSGLPSLLYVNGELHPMPMNTVMGIPGSSKGLEKLVSAETAARIDA
ESDSMDWPQEVTLGEVLRERFGDDLVDHVVSALQGGVYSSTSDDLSLRDTVPQLARALDR
LKEEGKPVTITAAVQSIMADREKRNKARGYKPSVFAAFPGGYAELYEALAEKSGAKIHID
AFITGIQWKDGFTLTGAEGTFDKVIVAVPAPTAAMLLKSVAPEASALLKNIKLASSAVVG
MKFDSAEGLPDNSGILVATDAEVTAKAFTFSSKKWPHLGQRGGALVRASFGRFGDDAIAR
ADEDLLVDTALDDLQTITGFDGRAAGLSEIYVQRWFGGLPVYGPGHSDLVAAIKDALPVG
IYATGAWADGVGVPAVIDSATKVAKLLEDH
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtattgcaatcattggtgcggggcttgcgggtttgactgcggcgtatcgtcttcgt
gaccatgatgtttcggttttcgaggcgactgaccgtattggtggcaagctgcatacggtt
gcgtttcagtctggccctacggatatgggcgcagaggcgtatttggcgtttcgtgaggat
acgacggccttttttaaggagttaggtcttgaggttgtgtcgccttcggggttgccgtcg
ttgttgtatgtcaatggtgagttgcatccgatgccgatgaatacggtgatggggattcca
ggctcgtcgaagggtttggaaaagttggtgagcgcggagactgccgcgcgtatcgacgcc
gaatctgattccatggactggccccaggaggtgactctgggggaggttttgcgtgagcgt
tttggcgacgacctcgtggatcacgtggtgtcggcgttgcagggtggcgtgtattcctct
acttctgatgatctttcgttgcgggacacggttccgcagttggcgcgtgcgttggatcgt
ctgaaagaagaaggcaagccagtcacaattaccgctgcggtgcagtcgattatggctgat
cgtgagaagcgtaataaggcccgtggttataagccgagtgtgtttgcggctttccctggt
ggttatgcggagctgtatgaggcgctggcggagaagtcgggtgcgaagatccacattgat
gcctttattactggcattcagtggaaggatgggttcacgctgacgggtgctgagggaacc
tttgacaaggtgattgtggcggttccagctccgacggcggcgatgttgttgaagtctgtg
gcaccggaggcgtcggcgttgctgaaaaacatcaagttggcgagctctgcggtggtgggt
atgaagttcgattccgcggaggggctgccggataattcgggcattttggttgcgacggat
gcagaggttactgcgaaggcgtttacattttcttcgaagaagtggccgcatttggggcag
cgcggtggcgcgttggtgcgtgcgtcgtttggccgttttggtgatgatgccattgcgcgt
gccgacgaagacctgctggtggataccgcccttgatgatcttcagactattacgggtttt
gatggccgtgcggctgggttgtcggagatctatgtgcagcgctggttcggtggcttgccg
gtgtacggcccagggcatagcgatcttgtggctgcgattaaggacgcactgccagtaggt
atttatgccaccggcgcttgggctgatggcgtgggtgttcctgcggtgattgattctgca
actaaggtggcaaagttactggaagatcactga

DBGET integrated database retrieval system