KEGG   Corynebacterium diphtheriae 241: CD241_0455Help
Entry
CD241_0455        CDS       T01687                                 

Definition
(GenBank) putative regulatory protein sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cdp  Corynebacterium diphtheriae 241
Pathway
cdp00010  Glycolysis / Gluconeogenesis
cdp00052  Galactose metabolism
cdp00500  Starch and sucrose metabolism
cdp00520  Amino sugar and nucleotide sugar metabolism
cdp00521  Streptomycin biosynthesis
cdp01100  Metabolic pathways
cdp01110  Biosynthesis of secondary metabolites
cdp01120  Microbial metabolism in diverse environments
cdp01130  Biosynthesis of antibiotics
cdp01200  Carbon metabolism
Module
cdp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cdp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD241_0455
   00052 Galactose metabolism
    CD241_0455
   00500 Starch and sucrose metabolism
    CD241_0455
   00520 Amino sugar and nucleotide sugar metabolism
    CD241_0455
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CD241_0455
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CD241_0455
Enzymes [BR:cdp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CD241_0455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AEX43522
Position
445175..446059
Genome map
AA seq 294 aa AA seqDB search
MTHALGVDIGGTKIAVGIVDTTDPTTVISRHIVPTPDNDVIDHVRDAIAHIITPEVTSIG
IGAPGVIDETTGVVVSSGPTMQGWAGTRIADTIAAEFSLPVAVHNDVRVMGLGESIYGAG
RDYTNVLFVSLGTGVGGAIVRDGRLVASPHHTAGELRALIGRLPDGRADLLENFAAGPGL
AQRFGERYPEHAGRDLRFIMELYHAGDTHARDYITATLAAAGETIAGFASAIDVDAIIIG
GGVGNIGDAIIKPFAHGFAAHAIPPLGTIPIRQAQLGTDAPIVGAAHLGHSAIA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacacacgcactcggtgtcgacatcggcggtaccaaaatcgcagtcggaatcgtagac
accaccgaccccaccaccgtaatcagccgacacatcgtacccacacccgacaacgacgtg
atcgaccacgtacgcgacgcgatcgcccacatcatcaccccagaagtaaccagcattggc
atcggcgcgccgggtgttatcgacgaaaccacaggcgtagtcgtctcctccggtcccacc
atgcaaggctgggctggcacacgcatcgcggatactatcgccgcggaattttcgctaccc
gtcgccgtgcataacgacgtccgcgtcatggggctcggcgaatccatctacggcgccgga
cgcgactacaccaacgtgctctttgtcagccttgggaccggtgtcggcggcgccattgtt
cgcgacggacgcctcgtagcatccccgcaccacactgcaggcgaacttcgggcactcatc
ggcaggcttcccgacggccgcgcagacctcctagaaaacttcgccgcaggacccggcttg
gcacaaagattcggtgaacgctaccccgaacatgcaggccgtgacctgcgattcatcatg
gagctctaccatgcaggagacacccacgcccgcgactacatcaccgcaacacttgcagca
gctggcgaaaccatcgcaggattcgccagcgccatcgacgtagacgccatcatcatcggc
ggcggagtaggcaacatcggcgacgccatcatcaaaccatttgcccacggattcgcagcc
cacgccattccaccgttaggaacgatccccatccggcaagcacaacttggcaccgacgca
cctatcgtcggcgcagcacaccttggccacagcgccatcgcataa

DBGET integrated database retrieval system