KEGG   Corynebacterium diphtheriae 241: CD241_0595Help
Entry
CD241_0595        CDS       T01687                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cdp  Corynebacterium diphtheriae 241
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cdp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CD241_0595 (rbsK)
Enzymes [BR:cdp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CD241_0595 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(588860..589765)
Genome map
AA seq 301 aa AA seqDB search
MSSSMTVVGSINADVSIQVARHPSPGETVLGHGSTISPGGKGANQAVAAALQGASVSFVG
AVGNDTYADHALKILRSSGVNLDAVETIDDNTGVAYIQVSDDGENSIIVIPGANAHVTAD
YVEHHRKPIEDADIVLLQGEIPADGFSAAVQAARGTVVVNLAPVIDVDRDCLLRADPLMA
NEHEAALILEQLGVPVTSEDPRVLIEALRSQGFASVVLTLGGHGALVADASGVTPIATPY
VTAVDTTGAGDAFAGAFVARRLQGDSLIDAATFAARVGAFSVQGRGAQTSYPSESDTLPA
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcatctatgactgttgttggttcgatcaacgctgacgtcagcatccaagtagca
cgacatcccagcccaggtgaaaccgtcctaggccacggctccaccatcagccccggcggc
aaaggcgcaaaccaagccgttgccgctgcgctccaaggcgcatcagtatctttcgtaggc
gcagtaggaaacgacacctatgccgaccacgcactaaaaatcctgcgatcttccggcgtg
aacttagacgcagtcgaaacaatcgacgacaacaccggcgttgcgtacattcaagtctcc
gacgatggcgaaaacagcatcatcgttattcccggcgcgaacgcgcatgtcaccgcggac
tacgtagagcaccatcgtaaacccattgaggacgccgacatcgtgctcttacagggtgag
attcccgcggatggttttagcgccgcagtgcaggcagctcgaggcaccgtggtagtcaat
cttgcgcctgtgattgatgtcgatcgtgactgtctcctacgcgcggatccgttgatggct
aatgagcatgaggcggcgttgattctagagcaactcggcgttccggtaaccagtgaagat
ccccgcgttctgatcgaggcactgcgttcgcaagggtttgcctccgtggtgttgaccctt
ggtggacatggcgcgctggtcgccgatgcttctggtgtgacgccgattgccaccccatac
gtcacagcagtagacaccacgggtgctggtgacgcattcgcgggggctttcgtggcacgt
cgtttgcaaggagactcgcttatcgacgccgccacgttcgcagcccgtgtcggagcgttc
tccgttcaaggtcgcggggcgcaaacttcttatccttctgagtccgatacgctgcccgcg
gtgtag

DBGET integrated database retrieval system