KEGG   Corynebacterium diphtheriae 241: CD241_0974Help
Entry
CD241_0974        CDS       T01687                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cdp  Corynebacterium diphtheriae 241
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cdp00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(991494..993692)
Genome map
AA seq 732 aa AA seqDB search
MVSPTQIAPVHPDVLHALKICQYHDPHGVYGWHEVDAERAVIRTRHIGAERVEALLSDST
VVELAAVGDDIFEAIVDHDASCDYRLRIHWQGGQVTEQADAYHFLPTLGDLDLHLINEGR
HERLWEVLGANPTTITTAMGDVEGTAFAVWAPNARGVAVIGDFCGWNPSQYPMRSLGSTG
IWELFIPNIGVGTVYKFAIHTHEGHRLDKADPMAKRAEVAPATGSIIASSSYTWNDDTWM
TNRAHTDHDNAAMSVYEVHLGSWNQGQNYEKLATNLVDYVKDMGYTHVEFLPVAEHPFGG
SWGYQVSGYYAPTSRWGTPDQLRLLIDAFHQAGIGVIVDWVPAHFPKDAFALGRFDGQAL
YEHPDWRRGEQKDWGTYVFDFGRNEVRNFLVANALYWLEEFHVDGLRVDAVASMLYLDYS
REPGEWLPNIYGGRENLEAVQFLQEMNATVHKSHPGVMTIAEESTSWPGVTSPTWEGGLG
FSMKWNMGWMNDTLEYFSHEPIHRMYHHNDITFSMVYAYSEKFVLPFSHDEVVHGKGSLW
TRMPGDAWNKAAGLRTLYAYMYAHPGKNLLFQGQEFGQVKEWSEERSLDWGDMDGWEGEY
HRGIRTLVQDLNALYKDSPALYSQDNNPAGFSWTKSDDAANNILSFVRYGADGSKILAVF
NFGGADHPSYKLGVPEGGNWKCILNTDAGIYEGADNYLDSDVMAWDTDWDGYQHSLTVHI
PAMSGQLYRWEA
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggtttctcctactcagatcgcaccagtccatcctgatgtcctccacgccctcaaaatc
tgccaataccacgatccgcatggagtatatggctggcacgaagtagatgctgaacgcgca
gttatccgtacccgccacatcggagcagaacgcgtggaagcattactcagcgattccact
gtggtagagctcgccgccgtaggtgacgacatctttgaagcaatcgttgaccacgatgct
tcctgcgattatcgcctaagaattcactggcaaggtggacaagtaaccgagcaagccgat
gcataccatttcctgccaacgctaggtgatcttgacctccacctcatcaacgaaggccgt
catgagcgactttgggaagtactcggcgcaaacccgaccactatcaccacggccatgggt
gacgttgaaggtactgcctttgcagtctgggcacctaacgcacgcggagttgctgtcatc
ggcgacttctgcggatggaaccccagccaataccctatgcgtagcctcggctcgaccgga
atctgggagctgttcatccctaacattggtgtgggaacagtctacaaatttgcgatccac
acccacgaaggtcatcgcctcgacaaggcagaccccatggcaaagcgtgccgaggtagca
ccggcaaccggctctatcatcgcttcctcctcctacacgtggaatgacgatacatggatg
accaatcgtgcgcacaccgaccacgacaacgctgcgatgagcgtctacgaggtccatctt
ggttcatggaaccaaggccaaaactacgagaaactagccaccaaccttgtcgactatgtc
aaggatatgggctatacccacgtggagttcctccctgtagcagagcatccctttggtggt
tcatggggctaccaagtttctggttactacgctcctacctcacgctggggtaccccagat
cagcttcgcttgcttatcgacgccttccaccaagcaggcatcggcgtaatcgtcgactgg
gtaccagcccacttccccaaagatgccttcgcactcggccgcttcgatggtcaagctctt
tacgaacaccctgactggcgccgcggtgaacaaaaagactggggcacctacgttttcgat
ttcggccgcaacgaagtccgcaacttcctcgtcgccaacgctttgtactggctcgaagag
ttccatgtcgatggactccgtgtcgacgctgtggcttccatgctgtatttggactactca
cgcgaacccggtgagtggcttccaaacatctacggtggccgtgaaaacctcgaagctgtt
cagttcctccaagaaatgaacgccaccgtgcacaagagccacccaggcgtgatgaccatt
gctgaagaatccacctcatggccaggagttacctctccaacgtgggaaggcggcctcggt
ttcagcatgaaatggaacatgggctggatgaatgacacactcgaatacttctcacacgag
cctattcatcgcatgtaccaccacaacgacatcacattctccatggtgtacgcatactct
gagaaattcgtgctccccttcagccacgacgaagtagttcacggcaaaggctcgctgtgg
actcgcatgccaggcgatgcatggaacaaagcagcgggtctacgcaccttgtatgcttac
atgtacgctcacccaggcaagaatctgctgttccagggacaagaattcggccaagtgaaa
gaatggtccgaagaacgaagccttgactggggtgacatggacggttgggaaggcgaatac
caccgcggtatccgcaccctagtgcaagacctcaacgcactgtacaaagactcccctgca
ctctacagccaagacaacaacccagcaggatttagctggacaaagtctgacgacgcagca
aacaacatcttgtctttcgtgcgctacggtgctgatggctccaagatcctagctgtattc
aactttggtggagcagatcacccaagctacaaattaggtgtgcctgaaggcggaaactgg
aagtgcatcctcaacactgatgcaggcatctacgaaggagcagacaactacctcgacagc
gacgtcatggcgtgggacaccgactgggatggctatcagcattccctcacagtgcatata
cctgcaatgagcggccagctctatcgttgggaagcttaa

DBGET integrated database retrieval system