KEGG   Corynebacterium diphtheriae 241: CD241_0998Help
Entry
CD241_0998        CDS       T01687                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cdp  Corynebacterium diphtheriae 241
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cdp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CD241_0998 (pfkA)
   01230 Biosynthesis of amino acids
    CD241_0998 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD241_0998 (pfkA)
   00030 Pentose phosphate pathway
    CD241_0998 (pfkA)
   00051 Fructose and mannose metabolism
    CD241_0998 (pfkA)
   00052 Galactose metabolism
    CD241_0998 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CD241_0998 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CD241_0998 (pfkA)
Enzymes [BR:cdp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CD241_0998 (pfkA)
Protein phosphatases and associated proteins [BR:cdp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CD241_0998 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1018030..1019058
Genome map
AA seq 342 aa AA seqDB search
MRIATLTSGGDCPGLNAVIRGIVRTCSEYGSTVVGYQDGWVGLMEDKRIQLYDDENIDRI
LLRGGTILGTGRLHPDKFKSGLDQIKANLEDAGIDALIPIGGEGTLKGAKWLSDNGIPVV
GVPKTIDNDVNGTDYTFGFDTAVSVATDAIDRLHTTAESHNRVMIVEVMGRHVGWIALHA
GMAGGAHYTVIPEQPFDIAEICKAMERRFQMGEKYGIIVVAEGALPKEGTMDFVEGGVDQ
FGHQTFNGIGQVIGEEIKKRLGHDVRTTVLGHIQRGGTPTSYDRVLATRYGVHAARACHN
GDYGKMVALHGEHIDLIPLEDAVDTLKTVPEGRYRTARALFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgcgactcttacatccggcggcgattgccccggcctcaacgctgtgatccgc
ggcattgtccgcacatgttctgagtacggctcgaccgtcgttggataccaagacggctgg
gtggggctcatggaagacaagcgcattcaactatatgacgatgaaaacatcgatcgtatc
ctgttgcgcggcggaaccattttgggtaccggccgccttcaccctgacaagtttaagtct
ggtcttgaccagattaaggcaaaccttgaggatgcaggtattgatgcactgattcctatc
ggtggcgaaggtacgctcaagggtgccaaatggctatctgataatggtattcctgtagtt
ggcgtgcctaagacgatcgacaacgacgttaacggtacggattacacttttggctttgat
accgcagtctctgttgctacggatgctatcgaccgactgcacactacagctgagtctcac
aaccgtgtgatgatcgttgaggttatgggtcgtcacgttggctggattgcgctgcacgcc
ggcatggcaggcggtgcgcattacacagtcattcctgagcagccatttgatattgcagag
atctgcaaggcaatggaacgtcgcttccagatgggtgaaaagtacggcattatcgtcgtg
gcggaaggtgcattgcctaaggaaggcacgatggactttgtcgagggcggcgtcgatcaa
tttggccaccaaacgtttaatggcattggtcaagtaattggtgaggaaatcaagaagcgc
ctcggccatgacgttcgtaccacggttttgggtcatatccagcgtggtggcacacctact
tcttatgaccgcgttttggctacccgttacggtgttcatgccgcacgtgcgtgccacaac
ggtgattacggcaaaatggttgcgttgcacggtgaacatatcgatctgattccgctcgaa
gacgcggtagatacgctaaagactgtccctgaaggacgttaccgcacagcacgcgccctg
tttggttaa

DBGET integrated database retrieval system