KEGG   Corynebacterium diphtheriae 241: CD241_1238Help
Entry
CD241_1238        CDS       T01687                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cdp  Corynebacterium diphtheriae 241
Pathway
cdp00010  Glycolysis / Gluconeogenesis
cdp00051  Fructose and mannose metabolism
cdp00562  Inositol phosphate metabolism
cdp01100  Metabolic pathways
cdp01110  Biosynthesis of secondary metabolites
cdp01120  Microbial metabolism in diverse environments
cdp01130  Biosynthesis of antibiotics
cdp01200  Carbon metabolism
cdp01230  Biosynthesis of amino acids
Module
cdp_M00002  Glycolysis, core module involving three-carbon compounds
cdp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cdp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD241_1238 (tpi)
   00051 Fructose and mannose metabolism
    CD241_1238 (tpi)
   00562 Inositol phosphate metabolism
    CD241_1238 (tpi)
Enzymes [BR:cdp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CD241_1238 (tpi)
Exosome [BR:cdp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CD241_1238 (tpi)
  Exosomal proteins of bladder cancer cells
   CD241_1238 (tpi)
  Exosomal proteins of melanoma cells
   CD241_1238 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM BCSC_C
Motif
Other DBs
NCBI-ProteinID: AEX44303
Position
complement(1292558..1293340)
Genome map
AA seq 260 aa AA seqDB search
MARTPLIAGNWKMNLDHLQAVATVQKLAFALPKEYYEKVDVAVTVPFTDLRSVQTLIEGD
KLAITYGAQDVSQHEAGAYTGEISAQMLAKLGCTWVVVGHSERREYHGESSELVAVKAKA
ALNQGISPIVCVGEPLEIREAGTHVEYVVEQTRASLAGLTADDLAKTVIAYEPVWAIGTG
KVASAADAQEVCAAIRNLIIELAGKEVAEGLRILYGGSVKAETVAEIVGQPDVDGGLVGG
ASLDGEAFAKLAANAATVVD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtactccacttatcgcaggaaactggaagatgaatcttgatcatcttcaagct
gttgcaactgtgcaaaaacttgcttttgcacttccaaaggaatactacgaaaaagtcgac
gtagctgtcaccgtaccttttactgatcttcgctctgttcaaacacttatcgaaggcgat
aagctcgctataacttatggtgctcaagatgtttcgcagcacgaggctggtgcctacact
ggtgaaatctctgcccagatgcttgccaaactcggatgtacttgggttgttgttgggcac
tcagagcgtcgtgagtaccatggcgaatcttcggagcttgttgcagtcaaagctaaagct
gcgttgaaccaaggaattagccccatcgtttgtgttggagagccccttgaaattcgtgaa
gctggaacacacgtagaatatgtcgtcgaacagactcgcgcatcgttggcgggtcttact
gcagatgatttggcgaagactgttatcgcctacgaacccgtatgggctattggtacgggt
aaagtagcatccgctgccgatgcacaggaagtctgcgcagcaattcgtaacctcatcatt
gagcttgctggtaaagaagtagctgaagggcttcgcattctttatggcggatcagttaaa
gcagaaacagtagccgagatcgtaggtcaaccggatgttgatggcggcttagtgggtggc
gcttctcttgacggtgaagcattcgccaaactagcagctaatgcagcaactgttgtcgac
tag

DBGET integrated database retrieval system