KEGG   Corynebacterium diphtheriae 241: CD241_1251Help
Entry
CD241_1251        CDS       T01687                                 

Definition
hypothetical protein
Orthology
K03500  
16S rRNA (cytosine967-C5)-methyltransferase [EC:2.1.1.176]
Organism
cdp  Corynebacterium diphtheriae 241
Brite
Enzymes [BR:cdp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.176  16S rRNA (cytosine967-C5)-methyltransferase
     CD241_1251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1306239..1307696)
Genome map
AA seq 485 aa AA seqDB search
MSGGFRSRSRSGDHLPVRSEKKQSTNRSRQPKRSSQSDPRWKPLRGIDLPRSVAFWVIQR
VEIDAAYANLTLPKVLKQSKLSGRDAAFATELTYGTLRTQGVLDTVIAECSSRELEALKP
EVRAALRLGAYQLLYTRVGAHAAVDTTVRIMEAIGQDRAKGFVNGVLRTISRTSPQSWIE
KLTPSGEVESIAFQHAHPAWIARSFSQIVGMNELEAALSADSERPKVHLVARPGEMSAEE
LALIVGGDEGKYSPYAVYLESGDPGALEPVREGLAAVQDEGSQLIARAVTEAPIHGEDQG
KWLDLCAGPGGKAALLGAIARIDGATVDAVEVSKHRAKLIENIVRGLPVKVTVGDGRSPG
LAPGYDRVLVDAPCSGLGALRRRPEARWRKQETDIEELTKLQSQLLESALRLVRTGGIVV
YSTCSPDLRETRQIVDRILRSHEVEELNAAELVPSMENTGEYKSVHMWPHRHGTDAMFFA
VLRKK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgagtggtggttttcgttcccgttcgcgctcaggcgaccatcttcccgtacgtagtgaa
aagaagcaatctacaaataggtctcgccaaccaaagagatcatcgcaatcagatccgcga
tggaagccgcttagaggaattgacctaccgcggtcagttgctttttgggtaattcaacga
gttgaaatagatgcagcatatgcgaatctcacccttcctaaagttctcaaacagtcgaag
ctttctggtcgcgatgcggcatttgctacggagttaacctacggcactttaagaacacaa
ggtgttctcgataccgtgatcgcagaatgttcttcacgggaacttgaagctttaaaaccg
gaagtgcgggcagcgctgcgcctaggcgcctatcagcttttatacacacgggtaggtgct
catgcagctgtagatacaaccgttcgaatcatggaagcaatcggtcaagatcgtgcaaaa
ggatttgtcaacggtgttctccgtacaatttcaagaacttctcctcaatcgtggatcgaa
aaattaactccatcgggtgaggttgagtcaattgcctttcagcatgcacaccccgcttgg
attgctcgaagtttttcccagatagttggaatgaacgagctggaggctgcattatcagca
gattctgagcgtccaaaggtgcacttggtagcacgcccaggggagatgagtgcagaagaa
cttgcgcttattgttggaggcgatgaaggtaagtattctccctatgctgtttacctagaa
tctggtgatccaggagcgctggaaccagttcgtgaaggtttggctgcggtccaagatgaa
ggcagtcaactaattgcgagagcagtgaccgaggctccaatacatggagaagatcaagga
aaatggcttgatctgtgtgctggtcccggcgggaaagcagcattacttggcgcaattgca
cgtattgacggtgcgacagtggatgctgtcgaagtgagcaagcaccgtgcgaagttgatc
gaaaacattgttcgcggtttgcccgtcaaagttacagtaggtgacggacgctcccctgga
ttggcgccaggatatgaccgagtattagttgatgcaccatgttctggacttggagcatta
cgacgccgccctgaagcgcggtggcgaaaacaagaaactgacattgaggaactgacaaag
ctgcaatcgcagttgctcgaatcggctttacggcttgtacgaactggtggaatcgttgtc
tactcaacgtgttccccagatttaagggaaacacgacagattgtggatcgaatacttcgt
tctcacgaagttgaagagcttaacgctgcggagctcgttcccagtatggaaaacactggt
gaatacaagtcggtacacatgtggccacatcgacatggcacagatgcgatgtttttcgca
gtgctgcgtaaaaaataa

DBGET integrated database retrieval system