KEGG   Corynebacterium diphtheriae 241: CD241_1302Help
Entry
CD241_1302        CDS       T01687                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cdp  Corynebacterium diphtheriae 241
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cdp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CD241_1302 (ruvA)
Enzymes [BR:cdp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CD241_1302 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1368387..1368998)
Genome map
AA seq 203 aa AA seqDB search
MIVSLRGTVESIGLGSAVIECNGVGYEVLAAPTTLGRLTRGEQARVLTTMVVREESQTLY
GFTDDASRRMFVLLQSVSGLGPKLALAAQSVFTTEDIARHIAGGDAKALQKIPGVGKRMA
ERMIVDLKDKVVGFNDGIPAAAQPQLSIAVDQAVQEQVLEALVGLGFSEKIALPVLSRVL
RDSPELSKSQALRAALSELGTKN
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgattgtttctctgagaggtacagtcgaatcgatcggtttaggtagcgctgtaatcgaa
tgtaatggcgtaggttatgaggtgctagctgcccccacaactcttggacggttaactcgg
ggagagcaggcgcgggtgttaaccacaatggtggtcagggaggaatcccaaacattgtat
gggtttaccgacgatgcttcacgacgcatgtttgttctgttgcagtcggtatcgggctta
ggtcctaaacttgccttagcagcacagtctgtttttactacggaagacatcgctcgacat
atcgctgggggtgatgccaaggctttgcagaagattcctggagtcggtaaacggatggct
gaacgcatgatcgttgatctaaaagataaagttgttggattcaatgacggtattcctgct
gccgcacagcctcagttgtccattgctgtcgatcaagcagtccaagagcaagtacttgaa
gctctcgtaggactagggtttagtgaaaaaattgcattgccagtgttgtctcgtgtgttg
cgggactccccagagctctcaaaatctcaagcattgcgcgcagcattaagcgaattgggc
actaagaactaa

DBGET integrated database retrieval system