KEGG   Corynebacterium diphtheriae 241: CD241_1436Help
Entry
CD241_1436        CDS       T01687                                 

Gene name
chlI2
Definition
magnesium chelatase subunit D (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cdp  Corynebacterium diphtheriae 241
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cdp00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1500247..1501332)
Genome map
AA seq 361 aa AA seqDB search
MSTKQSPLFPFSAVVGQDQLRLALILTAISPRIGGVVIRGEKGTAKTTTVRAFAALLGDA
PLVNLPIGATEDRVVGSLDMETVLTTGKAKFRPGLLSQAHGGVLYVDEVNLLADHLVDAL
LDAAATGQVTVERDGISHTAPACFVFVGTMNPEEGELRPQLLDRFGLSVDVAASKDVQIR
AEIMRRRLDFESDPIDFAQRWHALDENTSQAIKSAQERVDSIVLSDTNLARIAHICASFD
VDGMRADLVIARTAIAHAAWRGDSLVTDEDIKVAAELALPHRRRRDPFDEPGLDQDQLDE
VMDEARDQHPEMDDPAEQSAHEDQIENETSDQEDHLDDQETQTPDSDGQEGSASQGAPFR
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgaagcagtctccgctttttcctttttctgccgttgtaggccaagatcaactg
cgactcgcgttaattcttacagcgatttcaccacgaattggtggcgtagtaatccgcggt
gaaaagggaaccgcaaaaacgacgacggttcgtgcatttgcagcgttgctaggtgatgcg
ccactggtcaatcttcccatcggagcaacggaagatcgcgttgttggctcgttagacatg
gagactgtgctaacaacaggaaaagctaagtttcgcccaggcttgctctcccaagcgcat
ggtggtgttttgtacgtcgatgaggtcaacttgttggctgatcatctcgttgatgcgctt
cttgatgcggccgcgactgggcaagtgactgttgaacgtgatggtatttcgcatacagct
cctgcttgttttgtgttcgtaggaaccatgaatccagaagaaggggaattgcggcctcag
ctgctcgatcgttttggactttctgtagatgtagcagcatcgaaggatgttcagattcgg
gcagaaattatgcgcagacgactcgattttgaatctgaccccattgactttgcacaacgc
tggcatgcactagacgagaacacgtcgcaagcaatcaagagcgcgcaagaacgtgtcgat
agcattgtgctcagtgatacaaatttggcacgtatcgctcatatttgtgcttcttttgac
gttgatggcatgcgtgctgatctcgttattgctcgtactgctattgcccatgctgcatgg
cgcggtgattcgctggtgactgacgaggacatcaaagtagcagcagaacttgctctgccg
catcgacggcgtagggacccgtttgatgaacccggccttgatcaagaccaacttgatgaa
gttatggatgaagcacgtgaccagcacccagagatggatgatcctgctgaacaatcagca
catgaggatcaaatagaaaacgaaacttctgatcaggaagatcatctagacgatcaagaa
actcagactcctgattccgatggtcaggagggcagcgcttctcaaggcgccccctttcgt
ccctaa

DBGET integrated database retrieval system