KEGG   Corynebacterium diphtheriae 241: CD241_1445Help
Entry
CD241_1445        CDS       T01687                                 

Gene name
ispC
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cdp  Corynebacterium diphtheriae 241
Pathway
cdp00900  Terpenoid backbone biosynthesis
cdp01100  Metabolic pathways
cdp01110  Biosynthesis of secondary metabolites
cdp01130  Biosynthesis of antibiotics
Module
cdp_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cdp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CD241_1445 (ispC)
Enzymes [BR:cdp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CD241_1445 (ispC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AEX44505
Position
complement(1512912..1514075)
Genome map
AA seq 387 aa AA seqDB search
MRKKILILGSTGSIGTQTLEVIASRQDQFEVVGIAAGGRDPQLIIQQAQMLGLAADHVAV
ANEKSATQVSRALGAAVLSGRDAATDLVESVPADTVLNGLVGSMGLRATLATIQLGEVLA
LANKESLVAGGTFVTSQAAPGQIVPVDSEHSAMAQCLRSGASAEVSKLVLTASGGPFRGW
TREEMWDVTPEQAAAHPTWSMGQMNTLNSATLINKGLELIEATLLFDIPADRIEVTVHPQ
SIVHSMVTFCDGATIAQASPPSMLLSISHALAWPHRVPEAQPALDFSQASTWDFMPVDNE
AFPAVELAREVALKQGTYSAVYNAANEQAAAAFLRGRIKFPQIVDIVGEVVAGSSQFAGV
ASSVEEIIAHESESRRRADALVDKLSR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaagaaaatcttgattctgggcagcactggttccatcggcacgcagacgcttgag
gttatagcttcgcgccaagaccaatttgaggtggtaggtattgccgcgggtggccgagat
ccacaattaattatccagcaagctcagatgctgggtttggcggcagaccatgttgctgtg
gccaatgagaaatcggcaactcaagtcagtcgtgcacttggggcagcggtattaagcgga
agggatgctgctaccgacctcgttgagtcagtgccagcggatacggtacttaacggcctt
gtgggttccatggggctacgggccaccttggctacgattcaactaggtgaagttctggcc
ttagctaataaggaatcgttggttgccggtggtacgtttgtcacatctcaggcagcccca
gggcagatcgtgcctgtggattccgaacattctgcgatggcgcagtgtttgcgatcaggg
gcatcagcggaagtgtcaaagttggttctgactgcttcaggtggcccattccgcggctgg
acacgggaggagatgtgggatgttactcctgagcaagctgcagcacatccaacgtggtcg
atggggcagatgaatacattgaattcggccactttgataaataaaggattggagttaatt
gaggccactttgctctttgacatcccagctgaccgtattgaggtgactgttcatccgcag
tcgattgttcattcgatggtcacgttttgtgatggtgcaacaattgctcaagcatcgcca
ccatccatgttgctgtcaatttctcatgctttggcatggcctcaccgagttccagaagcg
caaccggctttggatttctctcaagcaagtacgtgggatttcatgccagtagataatgag
gctttccccgcagttgagttagcgcgcgaggtggctttgaaacagggaacgtattcagca
gtgtataacgcggcaaacgagcaggcggccgctgcgtttcttcgtgggcgcattaagttc
ccacagattgtcgatattgtcggcgaagtggtggcaggatcttcacagtttgctggtgta
gcctcatcggtcgaagaaattattgcgcacgaaagtgagtcgcgtagacgagcagacgcg
ctcgtcgataagctttctcgctga

DBGET integrated database retrieval system