KEGG   Corynebacterium diphtheriae 241: CD241_1504Help
Entry
CD241_1504        CDS       T01687                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
cdp  Corynebacterium diphtheriae 241
Pathway
cdp00340  Histidine metabolism
cdp01100  Metabolic pathways
cdp01110  Biosynthesis of secondary metabolites
cdp01230  Biosynthesis of amino acids
Module
cdp_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cdp00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    CD241_1504 (hisD)
Enzymes [BR:cdp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     CD241_1504 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEX44561
Position
complement(1578128..1579459)
Genome map
AA seq 443 aa AA seqDB search
MLNVIDLRGHVPTTSELRRTLPRGGTDINSVLPIVEPVVTDVKNRGAAAALDYGEKFDHV
RPTSIRVPQDVIDQALDSLDPNVIEALKESIARVRAVHSEQFPAQHTTSFGEGATITEKF
IPVSRVGLYVPGGNAVYPSSVIMNVVPAQEAGVESLVVASPPQKDHGGWPHPTILAAAKL
LGVTEVWATGGAQAVALLAYGDDTQQNSAEVLEPVDMITGPGNIFVTAAKRLVRGVVGID
SEAGPTEIAIVADAQANPVWIAYDLISQAEHDVLAASVLITDSEELAQRVNEEIAARYSV
TRNADRVSEALKGQQSGIVLVDDLPTAVIVADAYAAEHLEIHTAEPHKVAEQIRNAGAIF
VGGYSPVPLGDYSAGSNHVLPTSGSARYSSGLSTHTFLKPVNVIYYDEVALKEISDTVIT
LADAEDLPAHGEAIRTRFENLGN
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatgtgattgatcttcgcggacacgttcccaccacaagtgagctgcgtagaaca
ttgccacgaggcggaacggatattaattcggtattaccgatcgtcgagccagtggttacc
gacgttaagaatagaggtgctgctgccgcacttgattatggagaaaaattcgatcacgtt
cgcccaacatcaattcgagtgccgcaagatgtcatcgatcaggcactggacagcttggac
cccaatgtcattgaggcactgaaagaatcgatcgcccgagtgcgtgcagttcactctgag
caatttccagcccaacacaccacctcctttggtgaaggcgcaacaattacagagaagttc
ataccagtatctcgcgttggcctctacgttcctggtggaaatgctgtgtatccctccagc
gttattatgaacgttgtccccgctcaagaagcgggagtggaatcattagttgtggcttct
cctccacaaaaagatcacggtggatggcctcaccccactattttggccgccgctaagctt
ttgggagtaactgaggtttgggctacgggcggtgctcaagcagtggcattgttggcttat
ggcgatgatacccagcaaaatagtgctgaagtcttagaaccggtcgatatgattactggc
cctggcaatatatttgtcaccgctgccaagcgtttggtgcgcggggtggtgggcatcgac
tctgaggctggtccaacagaaatcgctatcgttgccgacgcgcaggcgaacccagtctgg
atcgcctatgatctcatcagccaagctgaacatgatgttcttgctgcttcggtccttatc
acggactccgaagagttggcacagcgcgttaatgaggaaatcgctgcccgctacagtgtc
actcgcaacgcagatcgcgtatctgaggctctcaaaggccagcaatcaggcatcgtgctt
gtcgacgatctcccgaccgccgttatagtggcagacgcatacgctgcggaacacttggaa
attcacacagcagagccccacaaggtggcagaacaaattcgaaacgctggtgcaatattt
gttggcggatattctccggtaccgctaggggattactcagcgggttcgaaccacgtactg
ccaacctctggaagcgctcgttatagctccggactttctacgcataccttcctcaagcca
gtcaacgttatttactacgatgaggtggcactgaaagaaatttccgacaccgtgatcacc
ttggctgatgccgaggaccttcctgcacacggcgaagcaattcgtacgcgctttgaaaat
cttggcaactag

DBGET integrated database retrieval system